CAZyme Information: AGR57_2295T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_2295T0-p1
• CAZy Family: GH16
• CAZyme Description: Glycoside Hydrolase Family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619		67790.37	4.4997

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC002:1591077-1593324(-)

Full Sequence      

MATSDSSCADLTPPADQHPPSPLLRPRPRYLDAHRYSAGSNSPFLGAGRPLSLGYEYTLA
PDPSTWGTSVTKEFKEEDDEMHEPGPARKIDRDGRIFSWRGLSNLGALVFVVVGVVALLT
GWPIIYHFTSHEQSTLGAYNLGGINASGQVPVLNGRFTLIDPDTPQDAYTRVSPHDPSQT
YELVFSDEFNTDGRTFYPGDDPYWEAEDLHYWATNNLEWYDPASVTTQNGSLMITLMEKQ
THDLNYQGGMVTTWNKFCFTGGYVEARAQLPGVSNIQGLWPAVWMMGNLGRAGYGATLEG
MWPYTYDSCDVGTVQNQSINGVPHAALINGDQGKGGVLSYLPGQKLSRCTCEGEDHPGPK
HSDGTFVGRAAPEIDMFEAQVTTSAPLSGGQLTGQVSQSAQWAPFDAGYLWQNSSATIYD
PSISVQNTFLGSVTQEATSIVSTTNPQCYEYPDPNFVPAAVSGSQLPAQVPGGPPAGAGC
FAVYGVEYKPGFDDAYITWLSNDKLTWTITAAAMGPNAETQISARPVPQEPMYLIANLGM
SYNFGPIDLAHIPFPVHLRIDYIRVYQPPNARNIGCDPPDFPTEQYIKNHIEAYTNPNLT
TWRDDYKHPWPKNSFLGQC

Enzyme Prediction     

No EC number prediction in AGR57_2295T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	187	566	1e-133	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	75	619	8	500	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.19e-143	183	567	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	6.50e-44	134	580	4	355	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	2.25e-24	185	566	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	5.58e-07	187	296	1	99	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV92705.1|GH16_2	5.81e-236	57	619	198	742
QRW06829.1|GH16_2	4.25e-235	57	619	195	739
QRV77885.1|GH16_2	4.40e-235	57	619	196	740
QRV91234.1|GH16_2	2.33e-231	48	619	79	603
QRV76399.1|GH16_2	9.42e-231	48	619	79	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	2.16e-10	181	324	24	175	Chain A, GH16 family protein [uncultured bacterium]
5WUT_A	1.05e-06	212	288	36	106	Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	3.36e-126	75	619	216	711	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	4.71e-122	70	619	251	763	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87023|KRE6_CANAX	6.39e-121	40	617	216	739	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|P87024|SKN1_CANAX	1.17e-120	36	617	222	736	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|O13941|YEPB_SCHPO	3.51e-117	75	619	131	627	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000002

TMHMM  Annotations     

Start	End
104	126