CAZyme Information: AGR57_2214T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_2214T0-p1
• CAZy Family: GH16
• CAZyme Description: Glycoside Hydrolase Family 79 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	PchrRP-78_SC002|CGC9	62153.22	4.4167

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC002:1424821-1426850(-)

Full Sequence      

MARAAALLLSPFFASAFAQAAIQVSPPAAPPGDNVTAVYSNFFGISFELSFINYYLGNDT
ASMPQPVLNYLGALHNRSSDRPLRLRLGGNSMDSSTYVPDQQQLLMFTDPNANVNDQPVS
FGSALFDVMGSLGTKVGTVEWLIGLSLRDPNSTNIPLVAGDAQKHLGDALDAYLLGNEPD
LYTSHGNRPGMANYTVYDYVGDYWVATGNLQHTPTDGDVLKLDKIAGPTICCAWDLDGVL
TSGWYTSFQDVLKYITLQHYPQNNCFGHYEYHLDYYMSHTQTVMLAKWQEPGLQIIASTP
SDQRKPVLMDEFNSASCGGVPESNMFGVGLWTADYALQMASVGYSGAYLHTREPGVSYNI
FDPPHSFPGGPGTWTTNTNFYAMLAVTEALQNANGTRVVDLNIDNSQSDYAAVHAGYALY
DKNTGAPHALALFNYANASAQSTDFALPKDFFAAGAGPVMVRYLSAPTATETANVTWGNF
TYSGVGDGMPVAATTQWTDRTYACADGCTVQVPGPGMAVVFITGPPSTTNTTGTTSSPSG
TSSGGSDGAKETNLFNAAPSGHQANTWAWTLLAGLTLAALLV

Enzyme Prediction     

No EC number prediction in AGR57_2214T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	41	442	4.2e-36	0.8351648351648352

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.04e-11	416	519	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEM76790.1|GH79	1.90e-95	22	525	23	501
ADV25490.1|GH79	1.00e-60	41	523	100	586
UOH85196.1|GH79	1.00e-60	41	523	100	586
AFR98329.1|GH79	1.92e-60	41	523	100	586
AUB28458.1|GH79	1.92e-60	41	523	100	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	4.28e-14	27	447	8	387	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	1.85e-09	127	498	119	446	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	1.90e-09	127	498	119	446	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	4.44e-09	127	498	139	466	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]
5BWI_A	8.16e-07	23	359	2	303	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

AGR57_2214T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000265	0.999738	CS pos: 18-19. Pr: 0.9474

TMHMM  Annotations     

There is no transmembrane helices in AGR57_2214T0-p1.