CAZyme Information: AGR57_2006T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_2006T0-p1
• CAZy Family: GH152
• CAZyme Description: Glycoside Hydrolase Family 47 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877	PchrRP-78_SC002|CGC7	96939.22	5.0507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC002:1013743-1017191(+)

Full Sequence      

MKWPTDWPKALLLLVLATLDAPPWPTRSIGSVAAAAPWTSDRKLQARSVACLNTTRELWY
HGFDSYMRYAFPMDELAPLSCTGRGPDWYNPANIATNDVAGNFSVTLVDVLDTFIVMNDT
TGFEKAVRNVIDWVSFDVNTKPQVFETTIRVLGGLLSGHQFATKPGQPFYIPWYRGELLT
LAHDLGKRLLPAFKTPSGLPFARINLRHGVRPGESMDSCTAGAGSLILEFGTLSRLTGDD
RFEKAAYKAFFALWNSRSDIGLVGNTVNIWTGLWTHPEVSSIGAGVDSFFEYALKWYILS
GEVEFLDVFQEAYAAVMRYSRSPDGFWYRSANIFTGDPAYLMVDSLSAFWPGLQVLAGDL
ENAIKSHMVYWNLWKKFAGLPEVWDMSYKAATSLQYPLRPELVESTWYLYRATRDPFYLD
VGERILSDIIVRAKVDCGLTGIGDLRTNHRDDRMESFVLSETLKYLYLLFDEENELHRDD
SNMVLSTEGHLLSMDHRLEKPISAIRRELRRVEHLSCPAYKPPMLAFDPVSATGLTGGVY
MRPDAEYVRALITAPATGTEEYVWSPGGTCQIPKVDLYTYDFLLSPDGQTVQEDFNPTSK
KLIPVPDGYVLQDVTGIRAHIVSRMDGKGYDVTKLGPYSVKTGQIVYVNDSHLLLAPLDG
KGPIDEDDAGPKYRVPEVELRIYVDLLSSSGAVLQLQHDVPTEAFVSASTATFGAVRFRR
GDTVRLVRDPANPFGCLPYKQRYAGEVLVVRRGECTFLDKLFEAAVAGAAGVIAISDEDH
SITPSAGVDELSAVGDVIDDVAIVVVNRADGEVLTAMLNAADTFGAGQVMAVVTPAESAA
HGGTSSLSPEAARQKARDGNRILYLNGHPLVNTRLMV

Enzyme Prediction     

EC	3.2.1.113:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	60	493	2.1e-137	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.63e-145	60	492	3	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.73e-72	56	490	77	514	glycoside hydrolase family 47 protein; Provisional
239047	PA_GO-like	0.003	705	760	18	75	PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10. This group contains various PA domain-containing proteins similar to the functionally uncharacterized Arabidopsis GRO10. The PA domain may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW05174.1|GH47	8.51e-279	1	818	1	818
QRV76268.1|GH47	5.34e-276	1	877	1	865
CCA68810.1|GH47	1.63e-261	38	809	27	805
QRW19457.1|GH47	1.15e-249	1	877	1	910
CDZ96368.1|GH47	8.29e-213	38	773	24	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	6.48e-52	57	492	11	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	7.41e-52	57	492	16	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	7.74e-52	57	492	16	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	3.30e-51	57	492	11	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	3.77e-51	57	492	94	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.92e-153	46	650	30	616	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	1.87e-144	56	500	130	587	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	6.63e-143	56	500	135	592	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	1.12e-122	40	490	26	474	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|Q9BV94|EDEM2_HUMAN	2.68e-121	56	481	40	452	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001873	0.998088	CS pos: 35-36. Pr: 0.3332

TMHMM  Annotations     

There is no transmembrane helices in AGR57_2006T0-p1.