CAZyme Information: AGR57_184T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_184T0-p1
• CAZy Family: GH13|GH13
• CAZyme Description: Copper radical oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	PchrRP-78_SC001|CGC10	84711.06	5.2818

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC001:381198-383669(-)

Full Sequence      

MVIRSFLALLTLVVLISVVLASESAWNGHTTPGSTKPARFAPYYVAPGTRSYDSNSPLVH
YSSHWKEIFSSAYIHKSVRSTSHKGAYVTFRFTGTGVEWFGNTGNRYGVAKVYLDGKLVD
RVDAWSSTTRQQQRLYWNFGLPYGKHTLKIVNTGEKEDSSRGTKIDMDAIVVTPGSKDIS
QAAIQTDYATSADFSAVSSSSSPKDGFASSDLAAFNPSETWTLTQKGNTGVHAMQLAVIS
ESHAIIVDKVEHNPLTVDGHPAWAALYNLDTHAVKPLRMQSNSFCAGGTFLSNGTLINVG
GNPVVEDHTAAADFGDMDGLQAVRIFEPCDSENVDDCEMFEDHNRVRMASPRWYNTVLRI
SDGSAMIIGGSLKGGWINNATTNNPTVEYYPPKDINGSNGMPVKLQFLVDTLNSNLFPIA
FSLPDGKVFIAANRDAMIYDWQTNTERRLPQIPNGVRVTYPMTGTGLLLPLTPENNYTPE
VLLCGGSTVDDTKPGYEISSQDPASAQCSRMVLTDDGIAAGWQVEQMPQARTMPDAVILP
TGKILIVNGAGTGISGYGNVVNQVGASNADNPVFTPVLYDPTASAGSRFSSAGLPTSNIP
RLYHSIATVVPSGSVMIAGSNPNLDRSEVKYGTEYRVEWLDPPYMTVDRPTLSDVPKKID
FKQTVQFNAKVPSGTAGDVKVVLMDFGYVTHAVHANSRYVELVSSVDGDVVMCNGPPDGK
IYPPGPGWLFVVANGIPSKGVKIMVGDGRSPEVNEAAIANVLANTSADQYDEDKKEKKFE
DDSE

Enzyme Prediction     

No EC number prediction in AGR57_184T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	218	764	4.5e-207	0.9857904085257548

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	2.44e-46	262	486	46	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
199882	E_set_GO_C	1.43e-28	644	745	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	1.34e-22	671	745	14	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
407839	CE2_N	2.95e-04	85	151	19	81	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD61577.1|AA5_1	0.0	1	784	1	784
VWO94850.1|AA5_1	0.0	3	771	3	731
CCA68855.1|AA5_1	2.75e-277	24	766	35	803
QRW24733.1|AA5_1	6.11e-267	21	748	25	721
QRW11955.1|AA5_1	2.24e-260	22	748	32	663

PDB Hits     

AGR57_184T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	2.12e-149	208	755	11	559	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	6.97e-71	220	738	16	514	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	9.07e-56	221	745	98	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	1.01e-46	228	745	76	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	4.20e-40	249	746	442	904	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999760	CS pos: 21-22. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in AGR57_184T0-p1.