CAZyme Information: AGR57_1569T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_1569T0-p1
• CAZy Family: GH13
• CAZyme Description: Glycoside Hydrolase Family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		97495.11	5.4067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC002:140355-144133(-)

Full Sequence      

MANLKRTVLNAGWSYALLDAHGTDAGGIKPGEWAPVQAFPTTVHVELLKAKKIPDPFIGL
NEWEVQWVGEADWAFKTTFSVEEKQLAAQNADLVFEGLDTFAVVLLNGTKILESDNQFVS
HRVSVVGLLKSTDNELVINFESAFRKGREIEAQHEKLNLWNGDSSRLHVRKAQYNYGWDW
GPVLMTTGPWKPIALETYSARISEIDIRVAIDDALTAKLDVFFAVAGPAQPLTAGVQILQ
PNNALIIGASNVRVQGGAKTCEFALSKGAYEPWYPVGYGQQPLYTAEITILDEQGNVLDV
RTQKFGIRSVKVVQDELVDQPGRTFLFEVNGIRIFCGGSNWIPADSFLTTMTRERYRDWL
QLLVDGNQNMVRVWGGGIYEADDFYELCDELGILVWQDFMFGCGQYPAYDSLLKSIEIEA
EQNVKRLRHHPSVVIFDYQVAESFKLDLDYSDEHSDFRKTNFPARHIYERLLPAVVEKFS
NIFYHRSSPYSGFGKPTTDRTYGDLHQWNVWHGSQEPWHNWDILAGRFVSEFGMQGYPDI
RTVDYWLGGDKAERYPQSRTMNNHNKADGFERRLELYLMENFKHAFDIESYVYYTQIMQA
ETLASAYRLWRRNWKGKGREYTAGALVWQINDCWPVTSWAIVDYFLRPKPAYYAIARELR
PYTVGMARKDVTSHPDALSAARVAIESRLEVWGTNSTLREKRATLVLAAFDLHSDWSERW
TRDVVLAPNAATELWAGTVPGQPVRTKLSDAPRTIVVSARLLDEYGEVLARYANWPEPFK
FIHFPDAQELGLEASVGADGESVRLSAKRPVKGIVLDVEGGGAEVRWGDQAIDLVPGDPQ
EVRAVGLQGRPVKARYLGDGTA

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	692	1.6e-84	0.6396276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	3.96e-70	5	720	11	706	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	5.57e-19	687	780	1	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236673	ebgA	9.97e-09	202	435	211	443	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	2.24e-08	200	308	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	0.001	200	312	182	280	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV91212.1|GH2	0.0	14	862	67	927
QRW19045.1|GH2	0.0	27	862	4	851
QRW05283.1|GH2	0.0	16	862	19	891
QRV76379.1|GH2	0.0	16	862	19	888
CCA67082.1|GH2	0.0	9	862	16	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.63e-139	1	843	21	809	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	5.07e-119	2	843	1	831	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	5.20e-119	2	843	1	831	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.32e-118	9	843	6	829	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	3.70e-118	2	843	1	831	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	2.99e-272	29	858	20	853	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	7.46e-238	1	859	1	845	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	6.55e-236	1	859	1	844	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B8NW36|MANBB_ASPFN	6.55e-236	1	859	1	844	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	7.66e-235	1	859	1	845	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AGR57_1569T0-p1.