CAZyme Information: AGR57_1563T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_1563T0-p1
• CAZy Family: GH13
• CAZyme Description: Carbohydrate Esterase Family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		32509.83	4.2427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC002:126720-127923(+)

Full Sequence      

MTTDIPGDEQLQPLAYDRSSKGTTRDSSLCRTQSQCTSSNSPGSFEFAVSKSHWQGLEHI
SRLIVFGDSFCRFGDENTWLSHFLQSINRGRQAKNKLEASNYASPGSTVEDDLADQLNAF
FKHYPKKSCPESTPSLDPNSTVYIFCLGINDCSRTDIDDLEELVNQLFEDGLDDVFVKAG
GRNFLLIDVPPKDRSPGARAVEEPDLGARYSTWNRLLRRRAEAFAADSPQASLFLFSSYK
VVTGILDDPAEYDFSEDDVDDVGAIWLDELHLSSEVHQVIAEELIEAFENL

Enzyme Prediction     

No EC number prediction in AGR57_1563T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	107	284	3.1e-25	0.7116104868913857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.21e-24	62	287	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
395531	Lipase_GDSL	4.48e-10	63	284	1	224	GDSL-like Lipase/Acylhydrolase.
238875	SGNH_plant_lipase_like	1.22e-09	101	256	79	260	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	8.28e-08	63	287	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238870	SGNH_hydrolase_like_1	1.22e-05	62	287	1	185	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA77953.1|CE16	5.60e-23	101	284	24	201
QRV97477.1|CE16	7.67e-19	48	284	34	284
QRV83277.1|CE16	8.74e-19	48	284	18	268
QRW11544.1|CE16	6.24e-18	53	284	25	268
QRV96959.1|CE16	6.24e-18	53	284	25	268

PDB Hits     

AGR57_1563T0-p1 has no PDB hit.

Swiss-Prot Hits     

AGR57_1563T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999979	0.000038

TMHMM  Annotations     

There is no transmembrane helices in AGR57_1563T0-p1.