CAZyme Information: AGR57_15055T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_15055T0-p1
• CAZy Family: GH12
• CAZyme Description: Glycoside Hydrolase Family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1000		107611.17	5.2278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC027:43902-47660(-)

Full Sequence      

MALLAFVLAAVLFLFAPHVANSAVPAQALLSEPPRHSTGLTDAVQWDNYTLWVEGQRIFL
HSGEFHTFRLPVPDLWLDIFQKMVAAGLNGVSIYIHWGITNPAPGVLDFEDWRALQPMFK
AAEQAGIFIVLRPGPYINAETTAGGLALWSTSLTQSELRTNATDIEDSWMPYVQRIIEET
KPNQVSAGGSVIAVQVDNEYSQNPIERAEYFAQLEATYKKNGIVVPLTYNDPGEGRNFIN
GTGAVDIYGLDAYPQGFDCSHPEAWRPVTTNYHTYHEEVNPSSVWYMPEFQGGSFDPWGG
PGYDACEVLTGPDFQDVFYKQNWASNAKMISYYMLYGGTNWGGIAAPVVYTSYDYGSALR
ESRALSPKFDELKRQGLFLRSSPEFRRTDWIGDSSTGVAVASTSNASFATLLRNPDTGAQ
FIIVRQADSTSTANIAFNLTVPSSSGTLTIPRTLSTGIQLGGRQSKVILTDYTFGNPANA
NKLVYSTAAILFAGTIGDVDVVFLYGDTNQGHEFALSFGGGKPITMAIHPTSKTGLQVAS
IPKSPKSPLVLWADTNTASTFFAPAVPTGSAKFTNFWQFGTNNTVLVGGPQLVRNATITG
SKLALQGDLNASVPLTLVVPAAVSSVSWNGANVPVRTLPGVATFAGVKLLTGELKYMLDK
SSFKVPTLTGWKFKDSLPEIQAGFDDSAWTTADHTTTNITAKPLFGDGRVLYGCDYGFCE
NIVLWRGHFNATGSETSVNLTLNGGAGFGASVFLNDVSLGTTNGSANIDQTNKLYAFPEG
AVKVGEDNVITVIVDSSGNDEDPTERSPRGIPGFLLNGGNFTTWKVQGKLGGYTNYPDKV
RGILNEGGLFGEREGWHLPGFDTSSWASRPLSSGLPTGKAGVGFFVTTFMLDVPKGVDAM
FSFVFDNNTAVPAGQAYRALLFVNGWQYGKRVANIGPQARFPVPVGILNPNGKNTVAVAL
WALVDAPVSPTLQLSLDNAVEGGVGPVAVNNPLWTPRHAK

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	51	374	3.6e-78	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	7.04e-74	50	374	1	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	2.24e-38	402	522	14	129	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	5.82e-36	850	963	1	108	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
198097	BetaGal_dom2	5.70e-30	396	561	8	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	8.73e-27	27	373	14	336	beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW00634.1|GH35	0.0	37	997	34	1004
QRW27580.1|GH35	0.0	21	997	9	1002
QRV86584.1|GH35	0.0	37	997	34	1004
QRW15140.1|GH35	0.0	37	997	34	1004
QRW10069.1|GH35	4.33e-302	37	983	61	1072

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	5.97e-198	44	997	6	967	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
3OG2_A	4.44e-189	40	998	22	1000	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
4IUG_A	6.61e-189	40	987	42	990	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
5IFP_A	3.24e-188	31	997	34	1003	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	9.04e-188	31	997	34	1003	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QL84|BGALC_ASPNC	7.55e-212	39	1000	23	992	Probable beta-galactosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacC PE=3 SV=1
sp|A2QA64|BGALB_ASPNC	9.24e-203	34	984	30	995	Probable beta-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacB PE=3 SV=2
sp|A7EZS5|BGALC_SCLS1	9.86e-203	39	985	23	964	Probable beta-galactosidase C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacC PE=3 SV=1
sp|A7EBU5|BGALB_SCLS1	2.08e-198	34	961	27	962	Probable beta-galactosidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacB PE=3 SV=1
sp|Q0CMF3|BGALB_ASPTN	1.72e-197	31	989	27	1004	Probable beta-galactosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=lacB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999733	CS pos: 22-23. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in AGR57_15055T0-p1.