CAZyme Information: AGR57_14675T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_14675T0-p1
• CAZy Family: GH11
• CAZyme Description: Glycoside Hydrolase Family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	PchrRP-78_SC022|CGC1	58551.45	8.2035

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC022:236965-240238(-)

Full Sequence      

MASTRATVSSHTTASLPRPHVLYFLDVTRTDGSTTRIAKRYSDFVELHAALKDDGTLPPK
RILVTAFLPSAWVDDKLIAERKTGLSAYLNTEPLHKDEYREHPLLKQFLSSSSPNSPNKD
ISLEDALPSTLSRKAALEAQAHINATTRIAAAYYPDWSADSIPPEKLDYSKFDILFFAFA
TPNSSSGINWDSGSTSILRRLVSNAKKSGKGTKIVLSIGGWGGSYWFSQAMSSAANRTTF
VNAAVNAVKTYGLDGIDIDWASREYPNSAGAGNPHSSADAANLLSFFTSLRKALGSSKLI
TAAVSHQPWLGANGSPLTNVSAYAAQMSYVNIMNYDVWGASSTPGPNAPLGNLCGTSRQP
QASAQAAFSQWTKAGFPANKLLLGLPLYGYVSHSSATTLTGVAMPPAAGFDVSLYRERPN
FLEGKHERGRAPAAAETAQAAAGDLSAYWGQQIAFNQIVALGALKKSGSVYVQQNGYTEG
WDDCSDTPFLFNVSRQTVITYDDTYSLADKAAYAKNSGMAGCFTWSLDQDDGYTLQDVIR
SSLGK

Enzyme Prediction     

No EC number prediction in AGR57_14675T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	151	533	2.5e-62	0.9358108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.67e-55	151	530	3	334	Glyco_18 domain.
119365	GH18_chitinase	2.16e-49	151	530	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	7.91e-48	151	530	3	307	Glycosyl hydrolases family 18.
225862	ChiA	3.28e-42	139	544	29	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119349	GH18_chitinase-like	6.01e-38	151	337	2	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ71457.1|GH18	7.90e-98	146	530	167	516
SJX66486.1|GH18	1.25e-96	146	530	168	517
CDI56735.1|GH18	4.24e-94	146	530	165	530
KGB76962.3|GH18	2.85e-92	153	544	456	830
QRV73087.1|GH18	4.47e-91	54	544	46	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.70e-47	151	531	5	356	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	1.86e-33	181	543	93	419	Chain A, Glycosyl Hydrolase [Niallia circulans]
6KST_A	5.32e-30	152	543	11	370	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	2.51e-29	152	543	11	370	Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	4.05e-28	164	543	25	370	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	1.21e-31	181	543	125	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q11174|CHIT_CAEEL	8.76e-24	200	544	117	424	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	1.30e-23	153	531	27	366	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q6RY07|CHIA_RAT	3.17e-23	153	531	27	366	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q13231|CHIT1_HUMAN	5.40e-23	164	531	43	364	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000010

TMHMM  Annotations     

There is no transmembrane helices in AGR57_14675T0-p1.