CAZyme Information: AGR57_1435T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_1435T0-p1
• CAZy Family: GH10
• CAZyme Description: Polysaccharide Lyase Family 14 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		32857.63	5.2380

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC001:3084684-3085714(-)

Full Sequence      

MFPSVWIPYLLLAVAACVAARPTANYTTQASISSPLFPVSPQLSYWTTSTSIPGALPLAD
STFRPHNQISALKHPYVNAPDGELSMQAYYPAGSYNFQNSPQGGFSFYAPGPASVDLTTA
KEATFAYTVYFPAGFNFVKGGKVPGLYGGNSDDEAVSCSGGRRDDGCWSARMMWRTNGAG
ELYTYLPPDFSQNQAVCDIPPYSTCNDVYGASVGRGSFDWATGGRTTVAERVRLNDVGQS
NGELQLFVGGKSVVNVGGLVLRNSSSGRIRGMQMQTFFGGSDPSWASPTNQYVWFSDFSI
AITETL

Enzyme Prediction     

No EC number prediction in AGR57_1435T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL14	84	300	9.6e-81	0.9861751152073732

CDD Domains     

AGR57_1435T0-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW21097.1|PL14_4	3.63e-77	36	304	127	397
ADE10038.1|PL14_4	2.79e-70	46	302	154	407
AUB27086.1|PL14_4	1.95e-69	32	302	245	497
AFR97104.1|PL14_4	1.95e-69	32	302	245	497
UOH83410.1|PL14_4	3.00e-68	32	302	245	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GMT_A	4.87e-34	85	300	58	270	Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai],5GMT_B Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai]
3A0N_A	4.97e-13	72	300	26	240	Crystal structure of D-glucuronic acid-bound alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_A Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_B Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3IM0_A Crystal structure of Chlorella virus vAL-1 soaked in 200mM D-glucuronic acid, 10% PEG-3350, and 200mM glycine-NaOH (pH 10.0) [Paramecium bursaria Chlorella virus CVK2]
6KCW_A	5.23e-07	113	297	62	234	Structure of alginate lyase Aly36B [Chitinophaga sp. MD30]
6KCV_A	1.71e-06	113	297	62	234	Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_B Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_C Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30]

Swiss-Prot Hits     

AGR57_1435T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999705	CS pos: 20-21. Pr: 0.9688

TMHMM  Annotations     

There is no transmembrane helices in AGR57_1435T0-p1.