CAZyme Information: AGR57_14226T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_14226T0-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
882		99397.05	6.0724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC019:484084-487380(+)

Full Sequence      

MDYDAYDALLHHIFRQTQGDAWFKPSEENVHAGVCLRVEPGHFRVFPYENRHLEPFEAAV
RALNPVVAVKMRSAAIHAALASVKDEGDSIFVDDDTRIQVLDTMSWLPRADKEQCGAFIR
DERVLVVWAYNLDDIIPTARDFDDKLIKLVWNRRQELTSMASAPQSDTGSYVNLTEKPTG
HLDEAEVAAIAKEKSAAADSKRAKDKEKKGRGCRFGLSYFVSSKEDVEKTADGPSQRPTR
LFAPFYCGVACALSIYFVASGVSILLVESVLDGTFIRFALLVTAPMLYCISIFFASQMIG
NLSMVIGPVAQYHQNSKYYSAVPPAPNKIVDANLPHVTIEMPVYKESLKETIAPSVYSLK
KAMQTYSRQGGTSSILIHDDGLQLISEEDRAERIAFYADNNIGWVARPPHSNAPDGYKRA
GRFKKASNMNYGLQLSLKLEKHMAAMMAEATARGEVIDEDDDIEERALQLAIEETYEESG
QRWRPWAHNARSLRIGDIILIVDSDTIVPEDCLRDAARELAECPEVAIIQHESDVMQVAH
HYFENGIAHFTRRINRCISLGCSNGEVAPFVGHNAFLRWSALQDAAFVDPADGVKKIWSE
ANVSEDFDMALRLMLKGYVIRWATYSDGGFKEGVSLTCDDELNRWQKYAYGCSELIFNPI
AQWWRKGPINKQLHMFMWCSAPVHYKVAMTSYMFSYYGIAAGLALSVMNYLLLGWSLDVD
GFYLHSFEIWLACMVVFPGAGNVGFTLLEYRLGHRNLLDALFENLKWVPFFFFFFGGLSI
HLTQALLAHMFSYNIQWGATKKEVERSNFWMEVPKIARRFWLALVSCTIIAAGMVVLATP
AVPAGWQILGWDWAVIFPLAITVGCHILYPIVLNPWLMIFSY

Enzyme Prediction     

No EC number prediction in AGR57_14226T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	498	715	7e-58	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.06e-53	498	713	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	8.72e-10	496	717	138	362	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	7.74e-06	455	651	30	227	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
133045	CESA_like	1.51e-05	456	606	31	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133043	CESA_CelA_like	2.80e-04	456	618	38	198	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP01253.1|GT0	0.0	1	860	1	856
BAC77594.1|GT0	0.0	2	882	39	927
CCA68526.1|GT0	0.0	1	882	1	871
CCA73139.1|GT0	0.0	1	882	6	924
CCA73141.1|GT0	0.0	2	882	36	994

PDB Hits     

AGR57_14226T0-p1 has no PDB hit.

Swiss-Prot Hits     

AGR57_14226T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

Start	End
245	267
274	296
693	715
728	750
770	792
820	842
855	877