CAZyme Information: AGR57_13663T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_13663T0-p1
• CAZy Family: CE1
• CAZyme Description: Carbohydrate Esterase Family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		41763.13	5.3250

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC017:457466-459072(-)

Full Sequence      

MHLLRTLLICALAACTHALSPKFLACQLKKPFGISPLVGCPIGTLFVSANSSSAHFTSVQ
QAIESLPEGRAATILIGEGVYHETVNISRAAPLTLLGQLDPRTAFDLAGNASTRNLVQIW
NNVFVENGIDDAQSAVLTVAPSFNASLIGAGPTGAPLQPLFGNIDFKAYNIDFQNRAANF
SISQALVTDISYANASFYGCTFASYQDTWYTGRNASTYVVDSIIFGQTDYLFGFGTAWFQ
SVTLANRACGGGIVAWKGTNLTDAPGNRYGAYISESRIIRSPDANATTVTAEQCFLGRPW
NDLATTVFLRTYMDDSIAPPGFKPFDSARPVIMNTTFYAEYKSFGPGGNTSQRVSDHILT
AAEANDFTIEKVFLGTPRWIDFEYVF

Enzyme Prediction     

No EC number prediction in AGR57_13663T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	47	373	7.7e-58	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215367	PLN02682	6.73e-34	41	380	67	367	pectinesterase family protein
395871	Pectinesterase	1.23e-32	47	375	3	296	Pectinesterase.
178087	PLN02468	7.02e-30	47	380	261	554	putative pectinesterase/pectinesterase inhibitor
215383	PLN02713	2.23e-28	166	375	342	549	Probable pectinesterase/pectinesterase inhibitor
178051	PLN02432	6.05e-28	51	380	18	292	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW07338.1|CE8	9.75e-162	20	384	21	378
QRV78409.1|CE8	9.75e-162	20	384	21	378
QRV93183.1|CE8	2.78e-161	13	384	14	378
QRW20843.1|CE8	1.95e-141	20	371	20	365
VWO95609.1|CE8	1.90e-94	67	237	21	197

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.03e-19	42	380	5	308	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.15e-14	200	375	125	300	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.45e-07	48	346	34	328	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RXK7|PME41_ARATH	2.26e-24	51	375	264	556	Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana OX=3702 GN=PME41 PE=2 SV=2
sp|Q9FHN5|PME59_ARATH	2.18e-23	47	380	223	525	Probable pectinesterase/pectinesterase inhibitor 59 OS=Arabidopsis thaliana OX=3702 GN=PME59 PE=2 SV=1
sp|Q9FF78|PME46_ARATH	4.81e-22	116	380	287	553	Probable pectinesterase/pectinesterase inhibitor 46 OS=Arabidopsis thaliana OX=3702 GN=PME46 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	1.17e-21	41	384	32	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q94CB1|PME25_ARATH	1.32e-21	166	380	393	604	Probable pectinesterase/pectinesterase inhibitor 25 OS=Arabidopsis thaliana OX=3702 GN=PME25 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999761	CS pos: 18-19. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in AGR57_13663T0-p1.