CAZyme Information: AGR57_13593T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_13593T0-p1
• CAZy Family: CBM13
• CAZyme Description: Glycoside Hydrolase Family 37 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		80998.53	4.3917

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC017:316864-319449(+)

Full Sequence      

MRTDLVALALWLAQGAHAMPQAVTTGVPTLTISTATPSPTAPLTNTLPSQVPLPPKQAWC
PSEIFCAGELLQTVNLAQPYPDQKTIVDKPTSKSSQQVLSDFNALFNSSTTEGSIVTFLD
NDFRGEGLELEAVALPSFNSDPAFLNNVSDPLLKAWSQVVHGYWTQLARSTNDSTLCPEG
TESGPCESTLIPLNHTFVVPGGRFREQYYWDSYWIIRGLLKSELYSVANDSIQNFMDELD
LFGFIPNGGRIYYLNRSQPPLFIHMVYDYVTTTNDTSIPARALPLAEKELAWWATNRTVT
VKSPFTNQSYSMARYAVNNTAPRPESYLTDYLTANDPTLSTPLTDDERAELYSELASGAE
SGWDYSTRFVKDPVAGGSNNTNPALRSYNIKNNIPVDLNSILYAAHNFLAELYESQGNSS
AANSHRSTAATIRTGILDLFWDPTKLAFYDFNLTSNARNDIFTAATFYPLWNGIVPDELL
NSTENAFGFFSVVNMVLNRYNGTVPVTFIESGLQWDAPNAWPPHQHIILEALKALPANVS
SGPLPKPGDNQSTYDLIPKGQLGIPEEQLPGQLIIGATNATKSGPGADINTLNGTVVNGG
NATAGEGWSQALQRELANRYFASAFCSWHATGGSIPDVLPRLSDQELNVTQSVNNTGNMF
EKFSISDIDSAGRGGEYTVQAGFGWTNGVVLIIASEYGNVLTTPQCPDLLAQAAATTAAT
TGSNGAVRGAPSLAALVLSSVLAVIYLL

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	80	536	1.1e-126	0.8655804480651731

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	4.59e-122	80	698	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.12e-112	65	698	13	545	alpha,alpha-trehalase
224541	TreA	3.59e-71	68	691	59	546	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	4.48e-64	19	698	1	537	alpha,alpha-trehalase TreA.
237326	treA	3.15e-62	18	691	11	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI56844.1|GH37	0.0	30	732	36	727
QRW20035.1|GH37	1.39e-262	37	712	59	738
CCA76060.1|GH37	4.75e-262	31	730	61	784
QRV92208.1|GH37	1.80e-255	90	712	112	738
QRV77412.1|GH37	5.12e-255	90	712	112	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	9.35e-62	81	698	39	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.23e-60	81	698	39	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	1.14e-55	68	691	15	496	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	1.81e-54	68	533	52	472	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	9.83e-54	68	691	15	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	5.85e-105	60	706	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|P19813|TREA_RABIT	4.48e-97	47	701	18	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	1.97e-96	47	702	18	555	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|A8J4S9|TREA_APIME	3.28e-95	56	702	37	573	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	1.38e-93	47	702	15	552	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999732	CS pos: 18-19. Pr: 0.9832

TMHMM  Annotations     

There is no transmembrane helices in AGR57_13593T0-p1.