CAZyme Information: AGR57_13547T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_13547T0-p1
• CAZy Family: AA9
• CAZyme Description: Glycoside Hydrolase Family 131 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		33920.00	5.0208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC017:239882-241057(+)

Full Sequence      

MHVLAVSTVVSVFATFVAATPVLYDGRAPFNLTNADLNSNTGPYLTVVKGSENATHYSSL
LGHSQLPTPLWNELLLLPHEQVVSISIDNSSVFVPGGGPPQFGFRRTEFIAANNGDHNDL
NPILETGTTVFHVSIKQDPTRPLNFTHEYQIVFIEPNDGTHVFEIQLGSPFTNPTGSLPA
PQAHSFKVRDHALNVLFETPFTPALWHNFAVQVDWTDRTLAVLYSTEAAPLAVVARPAPN
LSASPGAAGQGDFHFGVLKLPLVNPNDTPADQGDVVHFGIQEGTTEALLYSGVFVEDASH
GISVGYGLTIPALHSS

Enzyme Prediction     

No EC number prediction in AGR57_13547T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	22	307	1.3e-57	0.996078431372549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	8.25e-94	22	301	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV80910.1|GH131	6.52e-118	19	312	18	311
QRV95300.1|GH131	1.86e-117	19	312	18	311
QRW09714.1|GH131	2.64e-117	19	312	18	311
QRW22550.1|GH131	1.91e-104	19	312	18	309
CCA67309.1|GH131	9.66e-86	17	313	20	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W9A_A	3.73e-11	22	265	3	211	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

AGR57_13547T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000278	0.999702	CS pos: 19-20. Pr: 0.9719

TMHMM  Annotations     

Start	End
2	24