CAZyme Information: AGR57_13431T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_13431T0-p1
• CAZy Family: AA9
• CAZyme Description: Glycosyltransferase Family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
886	PchrRP-78_SC017|CGC3	99142.58	7.0971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC017:49814-53449(-)

Full Sequence      

PNPYDLHPSPSPNLYEHEHQPFQPLHVDPFATPGQPPVDAYHSPPLHPQAGPGYLDPYQS
HLHAASPPPLQSGIQPSPVPSSYTLAPGGSYDAPEQQDDFDTDTGDIPLLRRDNPPVSVP
GEYDPVAPDDKSESNIRYGRIPQRVPRRYKTIKKVELFHGNFVLDSPVPTKLLQMCAQKT
DREFTHMRYSAATCDPNDFKDSGFTLRQVHYDPPRRTELFIVMTMYNEDEELFCRTMHGV
MKNVAHLCKRDRSKTWGKDGWKKVVVCIVSDGRQKINSRTLSVIATMGAYQDGVAKNYVN
GKAVTAHIYEYTTQISVSPSMKIEGAEKGFVPVQIIFCLKEKNQKKINSHRWFFNAFGPI
LEPNVCVLLDVGTMPGPTSIYHLWKAFDINSNVGGACGEIVALKGKYGQNLINPLVAAQN
FEYKMSNILDKPLESVFGYISVLPGAFSAYRYIALQNDVTGEGPLQKYFLGEKMHGAGAD
IFTANMYLAEDRILCWELVSKRGGSWILHYVKSAYAVTDVPDQVPELISQRRRWLNGSFF
AAIHSTFHFHYIYRSSHSVLRKFWIHVEMLYQLFNLIFSWFALGNYFISFVILSESMEDP
SFHLGKGIHIVNIILEYMYVGLLVTCFLLALGNRPQGAKWFYTMAFVGFAVITVYMTIAA
FFLAFKGVDNIVKSDGPLTVSSLFTNAIFRNIVISLLATLGLYILASLIFFEPWHMVTSF
IQYVLLAPSYINVLNVYAFSNVHDVSWGTKGDNKPQTDLGVVNAGKNANEVEVEVVAAQT
DINAAYEDAIAVLSTKPPKSEPKPDPQTEQEDYYRSFRTNVLLAWTLSNALLAAIIVTAT
GKAADKGAHNTVNGYMAFILFSVAGLAFVRFVGSTTYMLVRLFAGE

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	225	387	9.3e-82	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	8.81e-121	225	387	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	8.43e-98	221	541	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	2.25e-36	154	224	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	6.60e-31	323	707	102	429	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.73e-15	326	455	46	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO98184.1|GT2	0.0	1	886	21	931
AZQ26798.1|GT2	0.0	7	886	41	902
QDK64616.1|GT2	0.0	7	886	41	902
BAF76741.1|GT2	0.0	1	886	24	927
BAF76742.1|GT2	0.0	1	886	24	927

PDB Hits     

AGR57_13431T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P87073|CHS1_PHYB8	0.0	108	885	48	841	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|J9VGT6|CHS8_CRYNH	0.0	121	886	276	1032	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|P30595|CHS2_RHIOL	0.0	135	885	103	858	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|Q99127|CHS4_USTMA	0.0	119	886	185	942	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2
sp|P30594|CHS1_RHIOL	9.28e-312	139	885	105	858	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

Start	End
571	593
610	632
642	664
688	710
720	742
821	840
855	874