CAZyme Information: AGR57_12815T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_12815T0-p1
• CAZy Family: AA7
• CAZyme Description: Glycosyltransferase Family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		48419.96	9.8828

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC015:394606-396005(+)

Full Sequence      

MSSPKSSALDVRARHLRILRLLSVSSLLLTVLLLYTASQFPLFDSSPLVLLSPRHDVLER
IAFPLFRWDAFHFAHIAQDGYVYEHEWAFFPGAPFVMRTVGELLRRIHAGDKLTVAHLLV
GGGLASLLCGTTTTLYDLTVHYFGSPSIAYLACVLSLLPSSPATLRFAAYTEPFFTYFSY
RGMLCCARSEWLHASLFFTVASTFRSNGFMLGGYILWGMVVGPFFAMQKVPLLRVGQAAL
LTGLIFTPFFYHQYNAYLAFCTGPHTPNTPPWCTFRVPFVYSYVQEKYWNVGLLRYWTAA
QAPNILLAAPVLGVLLAFCTAHTLRTTLPLVLSHPLFSRLAAFLPMARRTRSRFLSNTHI
VPHVLHALALSLILLVAAHTQIALRLAASLPTTYWAAAWLVVEHPRAGRWWVAWSVVWGA
VSVVLWAAFLPPA

Enzyme Prediction     

No EC number prediction in AGR57_12815T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	20	433	1.1e-88	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.60e-42	65	433	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.76e-16	68	433	74	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA72745.1|GT76	4.44e-87	30	433	32	430
QRV77141.1|GT76	1.64e-61	56	433	87	535
QRW06081.1|GT76	1.64e-61	56	433	87	535
QRV91959.1|GT76	2.34e-60	56	433	86	534
AAW42711.1|GT76	4.68e-50	37	433	29	423

PDB Hits     

AGR57_12815T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP62|GPI18_CRYNJ	8.32e-51	37	433	29	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|P0CP63|GPI18_CRYNB	4.42e-50	37	433	29	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.09e-37	56	404	54	424	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q5KR61|PIGV_RAT	5.93e-34	56	404	54	424	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q9NUD9|PIGV_HUMAN	2.92e-33	56	404	54	424	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000001

TMHMM  Annotations     

Start	End
21	43
113	135
148	170
203	225
232	254
297	319
355	377
381	403
410	429