CAZyme Information: AGR57_12613T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_12613T0-p1
• CAZy Family: AA7
• CAZyme Description: Glycosyltransferase Family 33 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	PchrRP-78_SC014|CGC1	59492.77	7.2783

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC014:956123-958117(-)

Full Sequence      

MPASYSTQALVLLGLGLLAFWVWLRAREKPSLRSVAILVLGDIGRSPRMMYHAESFAHLG
FKTYMIGNKGATPIPSLLSAPNVRFLYLPDPPKTMPGVPFVLYAPRKIVMQVFHILDALL
NRIPHPPEFILVQNPPSIPTLALVWFVGRVRGSKVIIDWHNLGYSILALKLGNGHPFVKI
ARWFESYCGRSAYAHLFVTKAMRDYLVENWALEGKKVVLHDRPPAHFHRATPAEVHQLFV
KLNSDLNVPSLTSFLPSYTPPKSTPFTALAADASTDVLSIVSAADGTFDGTLMPQLRQDR
PALLVSSTSWTPDEDFGMLLRALAVYERRARAADGRLPKVFMVVTGKGPDRARYMQEVAK
LQEGADGEEGWKYVRCVSVWLEAADYPIMLGSADIGISLHSSSSALDLPMKVVDMFGCGL
PVCALDFACLDELVKDGVNGLVFRDAEQLASELESLLTGFPNCPTLDTLRRSLLRNTPIE
PGRTERIGLRSPDSPGAQADAADWPGRTSESGAADEWEWSSWSQNWDRMMKPVILSDV

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	34	532	2.7e-146	0.9905882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	33	534	4	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	3.80e-146	33	457	5	371	transferase, transferring glycosyl groups
340825	GT4_WbuB-like	4.55e-14	42	458	12	361	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
340831	GT4_PimA-like	1.86e-10	83	458	34	332	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	4.86e-10	83	457	38	340	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA73277.1|GT33	4.85e-176	25	538	36	515
CED84249.1|GT33	1.78e-167	22	535	36	513
QRV76128.1|GT33	1.19e-138	91	538	3	411
KGB75402.1|GT33	1.27e-135	25	538	40	504
ADV19846.1|GT33	1.15e-133	25	538	40	504

PDB Hits     

AGR57_12613T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q921Q3|ALG1_MOUSE	1.14e-112	1	462	1	429	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q9BT22|ALG1_HUMAN	1.28e-106	1	473	1	441	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q5R7A2|ALG1_PONAB	2.01e-105	1	473	1	441	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1
sp|Q8L7M0|TUN_ARATH	5.49e-99	37	470	9	431	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1
sp|P90522|ALG1_DICDI	1.13e-84	32	466	1	424	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

Start	End
7	24