CAZyme Information: AGR57_11597T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_11597T0-p1
• CAZy Family: AA3
• CAZyme Description: Glycoside Hydrolase Family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041	PchrRP-78_SC012|CGC2	113443.16	5.1360

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC012:1229974-1234456(-)

Full Sequence      

MTTLSGPPWSSLQHAWAAMQELYTMTDSIANFPIPSMKALGRLAAYTLSAQVATSVVSSY
EVPPGSPGFYHGNSSAAVTFDAHSLFLDDKRLYVFSGEVHTWRMPSGPVIWHDVFQKMRA
AGFNAVSVYHHWGLSEGKQGSLNFDYYRSHTELYEVAQEVGLLVISRPGPYINAETTGGG
FPGWLTNNPARARTNESGFFEAWTPYMDAVSGFIKPYQYPDGPVIAVQSENEFFPSSPGD
PGRSESMVQIEDNLRKNGITKIPITHNDASPSGRYAHGLGEVDLYMWDSYPQGFDCANPT
SWPEINSGSLDTAHKAIDPDVFWASGEFQAGAFDPWGGSGYDKCFQLTNEQFANMVYKNN
YGAQTTYQSLYMTYGGTNWGNLAEPTVYTSYDYGAPIREDRTLSSKYSEIKLQASFLHAS
PDFLVATRFGNGTVGAGTAFSDSPRIYTTALSAPSGAHFYIVRPNSVKYTDATQFNLQVN
TTEGTLTIPQFGGNIDLDARESLILVSEYSFGSHTLKYSTAEVFTWTTIDSTDYLILYAN
SGHHVEAVIAGVQSGVPKITGSSSISAHFTDGKLLITGSPKGISTVSLGKVTIFVADKHA
ALSFWNVPLPSTKFTVYDRAPDVPSVLVFGPYLVRNATLARGGPTLALYGDINATTTLHV
VAPASVQRITWNGEAVDVERSSIGTLRGTLRFSAKAPDLPDLRNAEWFCADSLPEIRRGF
DDSGWVTANKTSTARPYQPFAGKYVLYADEYGFHQGNTITRGHFTGKNATGVQLSVQGGF
NFGYSAWLNSKFLGSNQGTNQYSPGGGIDLTNDTWSFGPEDLNDGDNVLTVVLDPTGLEE
DYDGDDSFKTPRGIRGYTLLGGGDFDSWKIQGNFGGEDFPDKVRGPLNEGGLFVEREGMH
LPGFAKGHWTRSRSCTPYDGITGAGIHAYLTTFDLDLPPNLDTPIALKITRTPASSYRSI
IYINGWQFGRFNSKDGPQEVFPLPEGILNHQGKNELLVTLWSLDAQGAKMADLELISTAV
VSTSKGSVGGLVESPTYHELR

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	85	412	5.6e-75	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	2.04e-80	84	412	1	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	3.30e-48	432	601	5	178	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	1.33e-32	434	604	8	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	2.34e-23	75	399	27	323	beta-galactosidase; Provisional
404274	BetaGal_dom4_5	5.70e-23	893	1004	1	109	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW07030.1|GH35	0.0	60	1031	514	1489
QRV92853.1|GH35	0.0	60	1031	88	1063
QRW07021.1|GH35	0.0	60	1031	88	1063
QRV78060.1|GH35	0.0	60	1031	88	1063
QRV78064.1|GH35	0.0	60	1031	514	1489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OG2_A	2.33e-219	78	1028	26	988	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
4IUG_A	3.49e-219	78	1039	46	1000	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
5IFP_A	6.26e-219	78	1037	46	1000	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.75e-218	78	1037	46	1000	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
1TG7_A	1.70e-216	78	1037	6	964	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UCU3|BGALA_ASPOR	9.03e-219	78	1039	46	1000	Beta-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacA PE=1 SV=1
sp|B8N6V7|BGALA_ASPFN	9.03e-219	78	1039	46	1000	Probable beta-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacA PE=3 SV=1
sp|A2QAN3|BGALA_ASPNC	2.69e-218	78	1037	46	1000	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1
sp|A1D1Z9|BGALA_NEOFI	8.98e-216	37	1028	1	991	Probable beta-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacA PE=3 SV=1
sp|Q4WS33|BGALA_ASPFU	8.98e-216	78	1028	46	991	Probable beta-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000009

TMHMM  Annotations     

There is no transmembrane helices in AGR57_11597T0-p1.