CAZyme Information: AGR57_11263T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_11263T0-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
977	PchrRP-78_SC012|CGC1	110090.02	6.1713

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC012:547742-551573(-)

Full Sequence      

MDYDRYDAFLHHIFKQTQGDAWFRPNEDNLSAGVCLRVNDGVNTPSGLPEFRVFPYENLA
LEPFEAAVARLNPAVAVKVRSAAVHAALAEVGPDDSSIYVDANTRIQILETMMDLPTADK
EQSAAFIRDERVLVVWSDSIDSIIPTCRDFEERLIKLLWRSRPNAASHPATSASSHPASV
NGESPRPLSWAAPLNVMHPGSLSGHGSMTNLNTRLSGMNGSRVNSMLPPPGTPRGVHGMS
VEDFATDLEKGVDDLSEKEAVKTKTKRTWWGKKKTVVVSDLEEGVPEPRPVMLYAPVYNG
LAFGLSIFFIGNGINTLLIEWQLDNDFTRFALCAIIPLLFAVSLFFCLQIFQNLCMAIGP
IAQYHQNSKYYSAVPPRPNKFVDNNLPHITIQMPVYKESLESVLAPSIESLKKAMQTYAR
QGGTSTIFINDDGLRVISREERDARIAFYANHGIGWVARPKHDDAPDGFKRAGRFKKASN
MNYGLALSLIAEKHLEQLQLQEKNRPSREGSAAGVHRNAREDRQFGLQYQDHDGDEQGVV
EVQRDENAPADTADEWEDLEEKALMLAIEEVYENSGRRWRPWAANGRACRIGEIILLVDS
DTVVPEDCLRDAAREMAECPTVAIIQHESDVMQVAHHYFENGIAYFTRRINKCISFTCAN
GEVAPFVGHNAFLRWKAIQDAAFVDTDGVEKIWSESNVSEDFDMALRLQLRGYIIRWATY
SKGGFKEGVSLTVDDELNRWQKYAYGCSELLFNPIVQWWRKGPINKQIHKFMWSSAPIHY
KISMMAYMFSYYGIAGSITIAIINYVLLGWEFPVDGFYLHSFEIWLATTVVFFGSGNLGF
ALLEYRLGEKPLFWGLLINCMWIPFFFFFFGGLSIPLSQAILAHLFSYNISWGATKKEVE
RSNFFKEIPKIAKRFWFPLTVSIIILAGIVVVSLPFVPVAWRIDGSGWAVIFPLALVCGC
HILFPILLNPWLMVFSY

Enzyme Prediction     

No EC number prediction in AGR57_11263T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	594	811	7.6e-60	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	9.99e-56	594	803	1	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	2.73e-12	592	902	138	429	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.22e-06	530	701	22	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224137	GT2	3.41e-04	593	809	86	284	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
133034	Glucan_BSP_MdoH	6.32e-04	560	746	52	250	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAH80454.1|GT0	0.0	1	977	1	1092
VWP01253.1|GT0	0.0	1	955	1	856
CCA68526.1|GT0	0.0	1	977	1	871
CCA73141.1|GT0	0.0	2	977	36	994
BAC77594.1|GT0	0.0	2	977	39	927

PDB Hits     

AGR57_11263T0-p1 has no PDB hit.

Swiss-Prot Hits     

AGR57_11263T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

Start	End
330	352
786	808
821	843
853	875
915	937
947	969
296	318