CAZyme Information: AGR57_11042T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_11042T0-p1
• CAZy Family: AA3
• CAZyme Description: ligninase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		39475.71	4.7643

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

Full Sequence      

MAFKQLLAALSVALTLQVTQAAPNLDKRVACPDGVHTASNAACCAWFPVLDDIQQNLFHG
GQCGAEAHEALRMVFHDSIAISPKLQSQGKFGGGGADGSIITFSSIETTYHPNIGLDEVV
AIQKPFIAKHGVTPGDFIAFAGAVGVSNCPGAPQMQFFLGRPEATQAAPDGLVPEPFHTI
DQVLARMLDAGGFDEIETVWLLSAHSIAAANDVDPTISGLPFDSTPGQFDSQFFVETQLR
GTAFPGKTGIQGTVMSPLKGEMRLQTDHLFARDSRTACEWQSFVNNQTKLQEDFQFIFTA
LSTLGHDMNAMIDCSEVIPAPKPVNFGPSFFPAGKTHADIEQACASTPFPTLITAPGPSA
SVARIPPPPSPN

Enzyme Prediction     

EC	1.11.1.14:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	46	307	2.5e-113	0.996078431372549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	0.0	29	359	1	327	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
403189	Peroxidase_ext	1.22e-25	290	361	1	72	Fungal peroxidase extension region. This region is found as an extension to a haem peroxidase domain in some fungi. This region is about 80 amino acids in length and forms an extended structure on the surface of the peroxidase domain pfam00141.
173823	plant_peroxidase_like	1.30e-22	49	294	3	246	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	2.59e-20	49	286	1	187	Peroxidase.
173827	secretory_peroxidase	1.07e-05	71	294	37	271	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAA33733.1|AA2|1.11.1.14	AAA33733.1|AA2|1.11.1.14	1.10e-275	1	372	1	372
CAA33621.1|AA2|1.11.1.14	CAA33621.1|AA2|1.11.1.14	6.34e-275	1	372	1	372
AAA53109.1|AA2	AAA53109.1|AA2	8.05e-200	1	369	1	370
P06181|AA2|1.11.1.14	P06181|AA2|1.11.1.14	4.64e-199	1	369	1	370
CAA38178.1|AA2	CAA38178.1|AA2	6.59e-199	1	369	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QPA_A	1QPA_A	4.45e-258	29	372	1	344	Chain A, Lignin Peroxidase [Phanerodontia chrysosporium],1QPA_B Chain B, Lignin Peroxidase [Phanerodontia chrysosporium]
1B82_A	1B82_A	1.06e-193	25	369	4	349	Chain A, PROTEIN (LIGNIN PEROXIDASE) [Phanerodontia chrysosporium],1B82_B Chain B, PROTEIN (LIGNIN PEROXIDASE) [Phanerodontia chrysosporium]
1B85_A	1B85_A	3.53e-192	25	369	4	349	Chain A, Ligninase H8 [Phanerodontia chrysosporium],1B85_B Chain B, Ligninase H8 [Phanerodontia chrysosporium]
1B80_A	1B80_A	7.12e-192	25	369	4	349	Chain A, PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8) [Phanerodontia chrysosporium],1B80_B Chain B, PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8) [Phanerodontia chrysosporium]
6A6Q_A	6A6Q_A	1.67e-190	25	369	4	349	Chain A, Ligninase H8 [Phanerochaete chrysosporium RP-78]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11542|LIG4_PHACH	sp|P11542|LIG4_PHACH	1.13e-275	1	372	1	372	Ligninase H2 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG4 PE=1 SV=2
sp|P06181|LIG8_PHACH	sp|P06181|LIG8_PHACH	8.25e-200	1	369	1	370	Ligninase H8 OS=Phanerodontia chrysosporium OX=2822231 GN=LPOA PE=1 SV=1
sp|P31838|LIGB_PHACH	sp|P31838|LIGB_PHACH	1.17e-199	1	369	1	370	Ligninase B OS=Phanerodontia chrysosporium OX=2822231 GN=LIPB PE=1 SV=1
sp|P21764|LIG3_PHACH	sp|P21764|LIG3_PHACH	2.36e-199	1	369	1	370	Ligninase LG3 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG3 PE=2 SV=1
sp|P49012|LIG2_PHACH	sp|P49012|LIG2_PHACH	8.80e-197	1	367	1	368	Ligninase LG2 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000187	0.999809	CS pos: 28-29. Pr: 0.7260

TMHMM  Annotations     

There is no transmembrane helices in AGR57_11042T0-p1.