CAZyme Information: AGR57_10960T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_10960T0-p1
• CAZy Family: AA3
• CAZyme Description: Glycoside Hydrolase Family 74 / Carbohydrate-Binding Module Family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887		91921.60	5.4153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC011:1249935-1253189(-)

Full Sequence      

MHWLTAFAALAASAASLAHAASPQAYTWKNVKIGGGGGFIPGIVFNPSQKGLAYARTDIG
GAYKLNADDTWSPLLDFADDARWNYWGVDALATDPVDPNRLYLATGMYTNSWDPNNGQIL
ISTDQGKTFTPSVLPFKVGGNMPGRGMGERLAVDPNSNNILFFGARSGNGLWKSTNFGQT
WTKVSSLPNVGTYKPDPTDTTGLNSDEAGVSFVTFDSTSGTSGGATPRIFVGVGTNTASN
LFMSNDAGATWSALPGTNSSWMPHKGVLSPAEKALYISTSDGTGPYDGTLGAVYKYDITA
GTMTDITPVSGGDLYFGFGGLAVDLQKPGTVMVAALNCWWPDGNVFRTTDGGSTWTRLWD
WAAYPTMNRYYTYDDSLAPWLGPEGTASSIVTQIGWMMEALAIDPFDSNHWLYGTGATIY
GGHDLLKWDTTRNVTLKSLADGIEETSVQALLSPPVGPTLLSGASAPFTSLDQSKLIAIP
VGFVHTDLTKAPSAEFQPSTASGITGLDYAGQNPKTIVRVGNGDASDGKQIAISNDSGNT
WALDYGSPDGVSGGKVAISAAGDTVLWSSSGNGVQVSQYTNPFSAVSSLPAGAAIASDKV
VNSIFYAGSGNQFYLSTDGGKTFAKQATLGTSSSVSTVIVHPAVTGDVWVSTDKGLFHST
NNGTSFSAISGVSQAWSISFGAPASTGGYPALFAIANIGGVGYFRSDDAGTNWVQINDAA
HGFGSASANVIAGDPRIYGRVYVGTNGRGIFYGDTAGTAPPTTASASSTSAVHSSTSTTS
SVHSTTSTTSSVRSSTSTTSSVRSSTSTSVTSHSTSASSTSSAPSSTASLQVAYGQCGGT
GWTGPTACVGKLYTLRMSLKDLRTFFFRQLGLSAQTSILVSTGNLCL

Enzyme Prediction     

EC	3.2.1.151:27	3.2.1.150:4	3.2.1.151:5	3.2.1.151:27	3.2.1.150:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH74	79	189	2e-24	0.4592274678111588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214740	VPS10	2.20e-06	117	201	55	136	VPS10 domain.
395595	CBM_1	8.98e-06	833	849	1	17	Fungal cellulose binding domain.
406353	Sortilin-Vps10	9.65e-06	70	184	12	112	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
271234	Sialidase_non-viral	4.20e-04	100	294	157	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
197593	fCBD	0.002	833	853	2	22	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAF95189.1|CBM1|GH74|3.2.1.151	0.0	21	887	1	854
QCR98306.1|CBM1|GH74	0.0	5	848	5	822
QCR98305.1|CBM1|GH74	0.0	5	848	5	822
VWO96677.1|CBM1|GH74	0.0	12	848	13	820
CDJ79827.1|CBM1|GH74	0.0	24	763	24	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LGN_A	1.18e-232	21	757	2	737	The structure of Acidothermus cellulolyticus family 74 glycoside hydrolase [Acidothermus cellulolyticus 11B]
6MGL_A	5.27e-225	24	754	4	745	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, D60A mutant in complex with XXLG and XGXXLG xyloglucan [Paenibacillus odorifer]
6P2N_A	1.09e-224	21	754	1	746	Crystal structure of Paenibacillus graminis GH74 (PgGH74) [Paenibacillus graminis]
6MGJ_A	1.73e-220	24	754	4	745	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_E Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_F Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_G Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_H Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGK_A Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer]
6P2O_A	2.36e-212	24	754	1	725	Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491],6P2O_B Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Z9M8|XG74_HYPJQ	2.48e-273	9	752	8	742	Xyloglucanase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel74a PE=1 SV=1
sp|Q3MUH7|XG74_PAESP	3.45e-230	20	768	32	784	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
sp|A3DFA0|XG74_ACET2	3.93e-203	7	763	14	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xghA PE=3 SV=1
sp|Q70DK5|XG74_ACETH	1.56e-202	7	763	14	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus OX=1515 GN=xghA PE=1 SV=1
sp|Q8J0D2|CBHRE_GEOS1	1.63e-106	4	754	11	784	Oligoxyloglucan reducing end-specific cellobiohydrolase OS=Geotrichum sp. (strain M128) OX=203496 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999750	CS pos: 20-21. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in AGR57_10960T0-p1.