CAZyme Information: AGR57_10929T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_10929T0-p1
• CAZy Family: AA3
• CAZyme Description: Polysaccharide Lyase Family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		84460.58	4.2957

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC011:1190477-1193363(+)

Full Sequence      

MATSTETGGSASSSGSALIVPSANTLSATSTSEPAAPSQTSASPDIELLTSRRLDFIVAG
AGSPSNISAWLSTLGSNGRWPDSEVDYTTGCDARRANWPAEAHWQRLVTMGAAWHGGLSG
AEQWVQDPTLLGDIHLAMDWWFENDFQNPSCLDSGGTDACPCGTPGLWNTNWFSNIILIP
NLVAQTCLLVSENLTDTEQGNCTHITGRSYGTFDHSINGVGILTGANLLDVARIGIDGGL
LNFNTSRLTDAYRRIHGEVVIENATRADGIRADGSFGQHTGIIYNGNYGKDYTNDVLLLE
IIAGGTQFAAGPENKDAFATLIDGDQWMIYRNVLTDVLHWDFSVLGRFISFPVIDAQATG
SININITEIEQLGEEWDSDTLTTVYDRLASPSADANVGGLTGNRMFFANDYMVQRGPGYV
TTVRMYSNRTKNTECTNDQNPFGFHLSDGTVYTYMQGNEYEDIAAAWDWNLIPGTTVDYN
GTALSCDEVGFIGLESFVGGVSDGSIGIAAMKFTNPITKALSWQKAWFFLVEDTQHVMIP
TIASSSNASVVSVLDQKRHNGEVFINGEPLRHRTNFTNPFSLWHDNVGYYFEQTCAPETL
SVEVGPKSGDWAAIGISTQGVETVDLFAAWVDHGTTNSSVPLSYSVFPAVSQEGFARKVL
ERPLQVIRNDADVSAIYDPVHRVAMFVFWDTPGTPTTFSPSPFEASITVSSSANSAVIYR
IDSQNVTVSDPSQTLTTLDVTFAVDDFGRKPPRWGPQSTKQLHFHLPTAGLAGDSVSQIL

Enzyme Prediction     

EC	4.2.2.3:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	404	652	2.7e-48	0.9884169884169884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396729	Lyase_8	1.11e-87	403	651	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
238517	GAG_Lyase	2.15e-85	64	731	35	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
400444	Lyase_8_N	1.08e-17	69	350	31	285	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
397152	Lyase_8_C	2.72e-12	667	739	1	67	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96784.1|PL8_4	1.09e-264	37	780	85	818
QRW05704.1|PL8_4	5.97e-220	45	780	22	774
QRV91637.1|PL8_4	9.58e-219	45	780	22	774
QRV76810.1|PL8_4	5.43e-218	45	780	22	774
QRV76817.1|PL8_4	6.15e-213	45	778	25	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F2P_A	2.42e-30	127	734	94	699	Structure of Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
2WCO_A	2.42e-24	106	742	93	722	Structures of the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
1RWA_A	1.27e-23	171	742	124	714	Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
1RW9_A	1.27e-23	171	742	124	714	Crystal structure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
2X03_A	2.97e-23	106	742	93	722	The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54873|HYSA_STRPN	1.14e-16	121	690	373	958	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
sp|Q53591|HYSA_STRA3	7.47e-16	169	678	368	927	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AGR57_10929T0-p1.