CAZyme Information: AGR57_10066T0-p1

Basic Information

• Species: Phanerochaete chrysosporium
• Lineage: Basidiomycota; Agaricomycetes; ; Phanerochaetaceae; Phanerochaete; Phanerochaete chrysosporium
• CAZyme ID: AGR57_10066T0-p1
• CAZy Family: AA1
• CAZyme Description: Glycoside Hydrolase Family 10 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	PchrRP-78_SC010|CGC1	38615.90	5.2707

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PchrysosporiumRP-78	13602	273507	0	13602

• Gene Location: location=PchrRP-78_SC010:688966-690437(+)

Full Sequence      

MFAFSISFVVLAGFLPLAMAAPGPTPVPAATAPASTSTAKLHQLIKSKGKTYFGTATDNP
ELTNQAYLANLDDNTMFGQITAANSFKWDATEPSRGVFTFANADTIANLARNNGQLLRGH
NCVWHQQLPAWVTNGNFDAADLTSIIQTHCSTLVSHFKGQTCVLLSWDVVNEPLNDDGTF
RQSVFFNTLGENYIPIALRAARAADPSTKLYINDFNIEGTGAKSTAMQNLVRSLQSQGVP
IDGIGIQSHLIVNELPPNIQQNIQAFANLNVDVAITELDIRMTLPSTPALLQAQKADYTL
VVQACMAVSRCIGITIWDWTDKFSFVPSTFPGMGAACPWDENFVKKPAFDGIAIGIGA

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	41	352	2.5e-93	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.50e-160	41	353	1	309	Glycosyl hydrolase family 10.
214750	Glyco_10	8.75e-121	87	352	2	263	Glycosyl hydrolase family 10.
226217	XynA	1.21e-82	10	353	5	338	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABZ88797.1|CBM1|GH10|3.2.1.8	4.06e-160	38	357	91	407
AAG44992.1|CBM1|GH10|3.2.1.8	4.06e-160	38	357	91	407
AEK97220.1|CBM1|GH10|3.2.1.8	4.06e-160	38	357	91	407
AAG44993.1|CBM1|GH10|3.2.1.8	4.06e-160	38	357	91	407
CAB05886.1|GH10|3.2.1.8	5.52e-159	40	355	18	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	3.49e-126	39	358	1	319	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
3WUB_A	1.64e-120	38	356	2	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUF_A	3.30e-120	38	356	2	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
6Q8M_A	4.51e-120	41	357	25	340	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3CUF_A	2.33e-95	53	358	15	314	Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellobiose-like isofagomine [Cellulomonas fimi],3CUG_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotetraose-like isofagomine [Cellulomonas fimi],3CUH_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotriose-like isofagomine [Cellulomonas fimi],3CUI_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylotetraose [Cellulomonas fimi],3CUJ_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylopentaose. [Cellulomonas fimi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HEZ1|XYNA_PHACH	7.21e-161	38	357	91	407	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|O60206|XLNA_AGABI	9.81e-160	40	355	18	330	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|B7SIW2|XYNC_PHACH	1.42e-158	38	358	81	399	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|B4XVN1|XYNA_STRSQ	1.19e-117	38	356	40	350	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|Q5ZNB1|XYND_TALFU	1.26e-116	39	356	19	334	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999741	CS pos: 20-21. Pr: 0.9828

TMHMM  Annotations     

There is no transmembrane helices in AGR57_10066T0-p1.