CAZyme Information: AFUB_097970-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_097970-T-p1
• CAZy Family: GT62
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742		80931.97	9.1384

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000009_A_fumigatus_A1163:1533016-1535244(+)

Full Sequence      

MKGYKKAGLVTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIVHGLDSM
MVGGVSMSSAGVNVMHACLSEQVVDDLLRKDLKFNGVVVSECLEMEALTHNIGVGGGTVM
AKNAGCDIILLCRSFPVQQEAINGLKLGVENGIIGRARIEQSLRRVLKMKAKCTSWDQAL
NPPGLPSLMQMQPSHTSLSKRAYNNSISVVRDKQNLLPLSNIIEPNEELLLLTPLVKPLP
ASAVSRSVTEHMNLSIDPIASDRTASVLSGESVFKELGRSLSRQRSGRVLHTSYTANGVR
PIHENLIDRASAVIVVTADANRNLYQHGFTKYVSLICRSQFSPSGEPREKPMIVIAASSP
YDFAMDTSIGTYVCTYDFTETALEALVKVLYGELTPKGSLPGSISRSQKLHQARQHWLVE
NWNEERDAQSLDTLLDAVRADCAQGQRSELLGVTSSSFLLRSEEIDEAHFVVRNSSTQAL
YGFCSTYFFRSTGTGVIGSLIVDPARRKLSIGNSLHNRAIRTLLQRKGMRRFQLGSRLPG
IYLGIPSSNPVERKRLRQWFANLGWNTALSRPVCSVVLRNLPTWTPPDGLIQGLKNADVS
YDLVHGWDYAEPILDHIKTNSRQGLIDIYKIALGGAPNCGIIRATRPSDGAILGTVVIYN
GRSSLAEHMPVLKATQPSSGGISSPVISPSVGEYATVMQGLVLLGIKQIRRQGAEAVVID
CVSSNPLYPAFQSFRSLPRLTG

Enzyme Prediction     

No EC number prediction in AFUB_097970-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	130	6.3e-25	0.5370370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395747	Glyco_hydro_3	2.83e-25	1	167	157	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.30e-16	1	165	152	308	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47105.1|GH3	0.0	1	722	350	1071
BCS15461.1|GH3	0.0	1	722	174	895
BCS03847.1|GH3	0.0	1	722	156	877
BAE65506.1|GH3	0.0	1	742	203	938
QRD92904.1|GH3	0.0	1	742	156	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	3.22e-45	1	565	166	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.15e-29	1	405	169	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.59e-23	1	404	208	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.16e-23	1	404	182	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.64e-23	1	404	212	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.33e-22	1	404	208	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	6.08e-14	1	220	175	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|Q1H075|NAGZ_METFK	6.36e-14	1	169	155	311	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1
sp|B4RQ67|NAGZ_NEIG2	1.70e-13	1	156	161	313	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=nagZ PE=3 SV=1
sp|Q5FA94|NAGZ_NEIG1	2.27e-13	1	156	161	313	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AFUB_097970-T-p1.