CAZyme Information: AFUB_093620-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_093620-T-p1
• CAZy Family: GT4
• CAZyme Description: Ortholog(s) have mannosyltransferase activity and role in mannosyl-inositol phosphorylceramide biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	scf_000009_A_fumigatus_A1163|CGC7	41982.45	9.1914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000009_A_fumigatus_A1163:213008-214207(-)

Full Sequence      

MRRGVLIFLIVNLLIISFLVRSVFTLLSLLVEDASADAIRHAELPSPNSSLIEQRPQIIP
KIIHQTYKNETIPEVWREAQQSCKDLHPDYEYILWTNEKSREFIKNEYPWFLDTFDGYKY
PIQRADTIRYFVLAHFGGTYIDLDDGCNRRLDPLLSYPAWVRRTVPTGISNDAMGSVPQH
PFFLRVIELLKSYDRSWLLPYITVMYSTGPLFLSVIWKEYMQDKPSEAARVRILMQDEYN
KYSWSFFTHHVGNSWHGKDARLIFWMGQHWMFLTVLGFILASVVGFCLWWVYGRMILLSS
KYRYRYSKLPGLGRLSSPTRRSRGVMPTLLRRVSFKEDEESAHVTETSFELYSRRD

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	155	5.6e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.71e-78	5	286	14	311	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.82e-25	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL85572.1|GT32|2.4.1.-	5.13e-266	1	356	1	356
CAK42232.1|GT32	2.04e-234	1	356	1	359
BCS14035.1|GT32	2.90e-234	1	356	1	359
BCS02358.1|GT32	2.90e-234	1	356	1	359
QMW44769.1|GT32	4.62e-233	1	356	1	358

PDB Hits     

AFUB_093620-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	1.13e-105	12	284	12	280	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.14e-104	1	284	1	288	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.89e-92	37	306	56	327	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.42e-86	48	284	46	283	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.85e-55	59	294	64	301	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.372563	0.627418	CS pos: 36-37. Pr: 0.3255

TMHMM  Annotations     

Start	End
5	27
270	292