CAZyme Information: AFUB_091960-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_091960-T-p1
• CAZy Family: GT34
• CAZyme Description: Ortholog(s) have pectate lyase activity and role in pectin catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	scf_000008_A_fumigatus_A1163|CGC10	25396.94	3.9856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000008_A_fumigatus_A1163:1573564-1574368(-)

Full Sequence      

MYQKSLLFSLLASSALAAQFPIPDSKGSVTFDEPYEIAAGETYDGGYKTYGRGVSCTGQS
EGGQDDTVFIVQEGGTLKNAIIGSDQIEGVYCLGACTIENVWWEAVCEDALSLKGGSGPY
NIIGGGAQGADDKVIQHNSGGQVNIDGFTVYDFGKLYRSCGNCDEQYARTVTIKNVVANS
GKTLVGINSNLGDTASIDSSTCATDVKKICVEYKGNDTGAEPEEISEGPSDACQYSEPLS
SC

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	25	215	1.5e-78	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	8.53e-113	21	219	3	199	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR91126.1|PL3_2	1.40e-126	1	242	1	252
EAA67075.1|PL3_2|4.2.2.2	1.95e-121	9	242	25	260
ABF50894.1|PL3_2|4.2.2.2	1.95e-121	9	242	25	260
QMW26393.1|PL3_2	1.90e-117	1	242	1	242
BAE55530.1|PL3_2	1.90e-117	1	242	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	6.26e-27	33	176	7	150	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	7.28e-24	24	176	3	156	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	7.45e-24	24	176	4	157	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	6.75e-23	24	176	12	165	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	6.75e-23	24	176	12	165	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGV9|PLYD_ASPFU	1.34e-179	1	242	1	242	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	1.34e-179	1	242	1	242	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	6.07e-169	1	242	1	241	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q0CJ20|PLYG_ASPTN	2.54e-128	1	242	1	246	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	3.46e-122	9	242	25	260	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000323	0.999669	CS pos: 17-18. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in AFUB_091960-T-p1.