CAZyme Information: AFUB_090600-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_090600-T-p1
• CAZy Family: GT31
• CAZyme Description: Ortholog(s) have pectin lyase activity, role in pectin catabolic process and extracellular region localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		45189.00	5.3326

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000008_A_fumigatus_A1163:1183429-1185119(-)

Full Sequence      

MIHAARGGALLQRYRIAAGAYIDGGEIDIRITLYRQFISVADLTNWWITGGLTFTGMKYA
AFLPTIGALVSQAIAIGVQGTAEGFASSVTGGGSATPVYPSTTDELVSYLGDSEARVIVL
TKTFDFTGTEGTTTATGCAPWGTASGCQVAINKDNWCTNYQSSAPSVSVTYDNAGSLGIT
VNSNKSLIGEGTSGVIKGKGLRIVSGAKNIIIQNIAITDINPKYVWGGDAITINQADLVW
VDHVTTARIGRQHYVLGTEASNRITLSNNYIDGESDYSATCDNHHYWNIYLDGSSDKVTL
KGNYLYKTSGRAPKVQGNTYLHAVNNYWNDNSNHAFEIGDGAYVLAEGNLFSDVTAAVES
SSFTGELFGSASASSTCQSYIGRDCVANSFSSSGTLSGSNVDVLSKFKGETVASASAAGT
SPASSAGQGHL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	169	352	7.4e-91	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.69e-55	167	354	2	189	Amb_all domain.
226384	PelB	8.54e-17	179	356	97	278	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	7.50e-15	179	351	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92196.1|PL1_4	1.19e-224	57	431	1	375
BAE65949.1|PL1_4|4.2.2.10	1.19e-224	57	431	1	375
QMW48793.1|PL1_4	1.19e-224	57	431	1	375
QMW36737.1|PL1_4	1.19e-224	57	431	1	375
UDD66064.1|PL1_4	1.19e-224	57	431	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	4.37e-177	76	431	1	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.11e-172	76	431	1	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	2.83e-168	77	415	2	341	Pectin Lyase B [Aspergillus niger]
3VMV_A	4.84e-08	184	354	80	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0YCL3|PELB_ASPFC	2.66e-265	57	431	1	375	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2
sp|B8NVB7|PELD_ASPFN	2.12e-225	57	431	1	375	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1
sp|Q2TXS4|PELD_ASPOR	2.12e-225	57	431	1	375	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|P22864|PELD_ASPNG	2.92e-199	57	431	1	373	Pectin lyase D OS=Aspergillus niger OX=5061 GN=pelD PE=1 SV=1
sp|A2RBL2|PELD_ASPNC	4.14e-199	57	431	1	373	Probable pectin lyase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.991275	0.008720

TMHMM  Annotations     

There is no transmembrane helices in AFUB_090600-T-p1.