CAZyme Information: AFUB_087880-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_087880-T-p1
• CAZy Family: GT20
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring hexosyl groups activity, role in GPI anchor biosynthetic process and endoplasmic reticulum membrane, integral to membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		46528.56	9.5967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000008_A_fumigatus_A1163:341011-342405(-)

Full Sequence      

MTSFFDSPSKVIGASIALRAVLLVYGAWQDAHSPIKYTDIDYFVFTDAARYVSRGASPYA
RDTYRYTPLLAWLLLPTTWDSIPGFFAFGKALFALADVVAGWLIAKVLVSAYGMSPSRAL
KYASVWLLNPMVANISTRGSSEGLLGVLVVGLLWAVLSRKVSLAGVILGLGVHFXXXXXX
XGPAVVWWFDAERDGSGSPRGTATARAAREKDDGQDGQGILSKAVDFLTPARIHLTLVAL
ATFSALNVSMYILYDLPFAQNTYLHHLTRIDHRHNFSPYSTLLYLSAAGGARTAFESLAF
IPQLLLSVVVIPLVLGKKSLAGTMLAQTFAFVTFNKVCTSQYFLWYLIFLPFYLPSSSLM
KNPRKGILVGLLWVIAQALWLQQGYNLEFLGLSSFVPGLFLASLFFFAVNVWILGIIVED
VGGSA

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	135	417	1.4e-86	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.36e-77	10	418	10	415	GPI mannosyltransferase
252941	Mannosyl_trans	6.60e-63	135	418	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65877.1|GT50	1.94e-222	1	421	1	410
BAE66105.1|GT50	4.83e-222	1	421	26	435
QRD92382.1|GT50	3.20e-221	1	421	1	410
QMW36573.1|GT50	4.14e-221	1	421	8	417
QMW48628.1|GT50	4.14e-221	1	421	8	417

PDB Hits     

AFUB_087880-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WAH2|GPI14_ASPFU	5.87e-298	1	425	1	425	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	3.45e-223	1	421	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	3.41e-204	1	423	1	430	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.87e-158	1	422	19	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.26e-155	5	420	7	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000012

TMHMM  Annotations     

Start	End
66	88
93	115
135	157
164	186
231	253
294	316
331	353
366	381
396	418