CAZyme Information: AFUB_085750-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_085750-T-p1
• CAZy Family: GT2
• CAZyme Description: Has domain(s) with predicted catalytic, carbohydrate binding activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	scf_000007_A_fumigatus_A1163|CGC5	62236.37	5.9413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000007_A_fumigatus_A1163:1752887-1754673(-)

Full Sequence      

MRLSSLVSLALAAGVHAKGPFLQKVDDTTYIIGNDLWNVTIGRQYGVKLYYKGKDLVGDA
VGHYVSYNGAQSDLNWTSAEIYRRGKTNGQDFLDIQFTAKEGDFHWVIFEDLVGAYQYFV
NHALPTLGEFRTLWRLDNTSFPNGRTNIKDGALPTLAEIASGTKVQDETWQLADGSYITK
YDWTAWIRDQDYYGVYGEEFGSWYINPGKDYYNGNHLKQELMVHRESSTGDAVQLNMIHG
THFMVSSNDVFPDGKVWGPWLWYLNDGSKTDAAARAAAEFKAWPYKWFEDEAYQSRGSVS
GRLVLSDGRPAAGASVFLGDNHPDKTALDMGTTYYYTGQTDDKGWFKFEDVRTGAYGLQA
WSNGGQLADVATSFLQNDVTVRKSHTAKLGTLRWEVPSRTRIFQVGDFDRKSLGFRYGGA
PYEHALVAQCPANLTYTVGQSTTADWCFGQAALGTWSIRFQAAKSSAALLTVSLAGYSSG
TTSTILLNGDAASPIGNLTTLPNDPCLYRSATTAGEWRLFQFEIPQGKLQPGWNSIDFAV
GKASRWHGFMWDSIILEYL

Enzyme Prediction     

No EC number prediction in AFUB_085750-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	31	542	2.7e-249	0.9903660886319846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	6.01e-59	21	269	1	261	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	5.35e-47	401	556	1	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199905	RGL4_C	1.22e-30	403	557	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	1.57e-17	295	392	1	92	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
404503	CarboxypepD_reg	7.46e-08	298	389	1	77	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO65538.1|PL4_5	8.77e-281	17	558	25	574
BCS19874.1|PL4_5	4.43e-259	3	558	5	572
UQC83548.1|PL4_5	5.26e-247	3	554	127	703
CBY02118.1|PL4_5	1.63e-244	21	557	32	569
CAE6996798.1|PL4_5	3.53e-242	6	557	9	563

PDB Hits     

AFUB_085750-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RJP2|RHIE_DICD3	1.56e-58	6	536	14	557	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999713	CS pos: 17-18. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in AFUB_085750-T-p1.