CAZyme Information: AFUB_084590-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_084590-T-p1
• CAZy Family: GT2
• CAZyme Description: Protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710		80806.60	8.7101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000007_A_fumigatus_A1163:1424462-1426774(-)

Full Sequence      

MSTKTKMLARENGSIGERIYVPENLLASVTATDDQGHCNRQSYSSSEEDSPVGEIHVAKK
RASTISWSEHGGYQATTRHGHLSRVFTIEEGQEDVCISEYSKTNDDPSTPSSGSISREYP
VDGSYNAASSQEHQGCQYTHASFHPRTHNRFSYRNSLPVGQALRSTPRDIRKGSVRSLYN
RAALVKIKHQRRYWRRLLFEYAVYTVLVLFVYFVLVGVTLWKGAVWWLHWIMQKKTVFQG
GWAIVIGLLVFYSYTPLLITFEDTFPGPEFFHQRRIAPHPTDTALLIPCYRSATIIGRTL
EAALQIFPASHIYVIANGNSSQPLDNTEEICRSYGVNHIWSPVGSKIIAIFIGCYAVKDF
QNVLLIDDDCILPPNFPVVVSRLNEEVRCIGYTIKSVGPDSSRGSYCQQAQDLEYKLSGL
TRCFAGRIGSATFPHGAISLWERTFLKRTLHNHPGFSISEDWFLGDSCRRLGGRIQMCSA
VFVETTTPASVLFGEINEARGGFGEPTVFRQRFLRWNFFVANGLWYNLSYLFTSWKLGRW
EFATKLLVIQEIYETLLYILTPFTLPISFIVRPEFCTVLLMSTLGLYLLHVIIFNEVHLR
LKNERIGWKVVLGYYMPYKLLMTFTNVASCYWSLVKYARYFARRHPKLIEDHEAVGMVLK
LEDMTGRMGGIPEGQGLRRSMTVRTVDVDAAVNNRDFLIAELPAERYPSG

Enzyme Prediction     

No EC number prediction in AFUB_084590-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	280	500	1.3e-33	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	3.34e-38	280	504	1	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
224136	BcsA	2.32e-15	243	639	22	405	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.12e-11	285	461	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
132997	Glyco_tranf_GTA_type	1.77e-08	286	391	2	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
404513	Glyco_trans_2_3	1.20e-07	363	571	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW36583.1|GT2	6.54e-277	17	704	11	685
QMW48638.1|GT2	6.54e-277	17	704	11	685
UDD65887.1|GT2	3.75e-276	17	704	11	685
QRD92372.1|GT2	2.03e-266	17	704	11	697
CAK39025.1|GT2	8.08e-262	2	688	40	730

PDB Hits     

AFUB_084590-T-p1 has no PDB hit.

Swiss-Prot Hits     

AFUB_084590-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000001

TMHMM  Annotations     

Start	End
197	219
239	261
513	532
547	569
576	598
613	635