CAZyme Information: AFUB_083960-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_083960-T-p1
• CAZy Family: GT1
• CAZyme Description: Ortholog(s) have polygalacturonase activity and role in pectin catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	scf_000007_A_fumigatus_A1163|CGC15	52117.92	7.6099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000007_A_fumigatus_A1163:1239076-1240655(+)

Full Sequence      

MKFFALAALFASTVNSIAVDGLIPGARVIPANDVVALKKAGAYHQKHHHRRTVIIRSSSS
DEDDVSADFLWGIKRANHGGRLLLQNGKKYVIGKKLDLTFLKDIEVQLDGELKVLWPKIL
DPVLAGVNTIEKFTNDVPYWQANNFYYDFQKSISFWRWGGEDIKIFGSGVLNGNGQRWYN
EFAGQEILDPNNKYYRPILFVTENATRVSVEGITQLNSPCWTNFFVRTKDISFDNVFIHA
YSTNASALPKNTDGFDTLNVDGLTVTNTRVDIGDDCLSPKPNTTNVFVKNLWCNGTHGAS
MGSIGQYPGVLDIIENVWIENVTLLNGENGARLKAWAGPDVGYGRINNVTYKNIHVENTD
NPIVLDQCYFNINATQCAAYPSRVNFTNIVFEDIYGTSSGKRGKVVADLTCSPNAVCSGI
RLKNIHLTSPAGSPPVIVCDGIQGDIGVECQSSSNSTTKRSVDLARSLKYRA

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	142	444	3e-67	0.8123076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.17e-42	159	442	49	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	1.53e-30	148	463	126	435	Probable polygalacturonase
177865	PLN02218	6.98e-29	167	427	164	408	polygalacturonase ADPG
215120	PLN02188	3.76e-28	198	432	158	379	polygalacturonase/glycoside hydrolase family protein
165802	PLN02155	5.67e-28	235	448	178	385	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92857.1|GH28	1.86e-251	1	455	1	435
QMW36166.1|GH28	1.86e-251	1	455	1	435
QMW48226.1|GH28	1.86e-251	1	455	1	435
UDD65414.1|GH28	1.86e-251	1	455	1	435
UPX44877.1|GH28	2.57e-247	1	454	1	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	2.03e-46	64	455	26	387	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
6KVE_A	1.09e-20	160	450	75	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.47e-20	160	450	75	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	4.46e-20	160	450	67	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1HG8_A	1.92e-18	160	397	68	304	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBK6|PGXB_ASPFU	0.0	1	472	1	453	Probable exopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pgxB PE=3 SV=2
sp|B0YAA4|PGXB_ASPFC	0.0	1	472	1	453	Probable exopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgxB PE=3 SV=2
sp|A1DAX2|PGXB_NEOFI	1.02e-308	1	472	1	453	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1
sp|Q0C7H7|PGXB_ASPTN	4.03e-253	1	455	1	435	Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxB PE=3 SV=1
sp|B8NX60|PGXB_ASPFN	3.30e-252	1	455	1	435	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000467	0.999526	CS pos: 16-17. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in AFUB_083960-T-p1.