CAZyme Information: AFUB_081200-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_081200-T-p1
• CAZy Family: GH88
• CAZyme Description: Has domain(s) with predicted extracellular region localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		38418.92	12.3849

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000007_A_fumigatus_A1163:432612-433865(-)

Full Sequence      

MRALSVFVALFSFLALSSASPGQDVAKRVTSGSLQQVTNFGSNPSGTLMYIYVPNNLATK
PGIVVAIHYCTGTAQAYYTGSPYAQLAEKYGFIVIYPQSPYSGTCWDVSSQSALTHNGGG
DSNSIANMVTWTISQYNADTSKVFVTGSSSGAMMTNVMAATYPELFAAATSTPASPPAVS
TPPPTKSTAGTAAAPRATSSAPQRSGAVSPKQCTRGIPGHGPACRSTTAAWIPLSTRRIT
TKPASSGRVSSGTTITRRSRPRATPRRRTTRLPSGARICRASLQRASDIRFLFMGSRTWS
GLGLPGVRRRRRLLLQRLRRRARRHRRGGRRPALVLQSTGVNVAVMGGRGRRRVRAGIPA
P

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	49	176	9.1e-19	0.5638766519823789

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.39e-27	49	194	1	152	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	1.20e-19	14	216	19	219	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	3.50e-14	51	252	5	216	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	2.12e-08	48	175	381	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	8.18e-08	84	169	219	297	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM93261.1|CBM1|CE1|3.1.1.72	7.99e-91	5	170	7	173
QBA31203.1|CBM1|CE1	5.95e-87	1	170	1	174
ADX07526.1|CE1	6.10e-81	28	170	23	165
QMW35424.1|CE1	6.29e-74	31	168	32	169
QMW47486.1|CE1	6.29e-74	31	168	32	169

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.81e-74	31	170	1	140	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBW4|AXE1_ASPFU	9.79e-111	1	170	1	170	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	3.77e-107	1	170	1	170	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|Q8NJP6|AXE1_TALPU	1.42e-91	5	170	7	173	Acetylxylan esterase A OS=Talaromyces purpureogenus OX=1266744 GN=axeA PE=1 SV=1
sp|B8NBI2|AXE1_ASPFN	1.12e-74	31	168	32	169	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	2.23e-74	31	168	32	169	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999742	CS pos: 28-29. Pr: 0.6009

TMHMM  Annotations     

There is no transmembrane helices in AFUB_081200-T-p1.