CAZyme Information: AFUB_078360-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_078360-T-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: Has domain(s) with predicted calcium ion binding, mannosyl-oligosaccharide 1,2-alpha-mannosidase activity and membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		99080.84	6.2457

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000006_A_fumigatus_A1163:1802412-1805207(+)

Full Sequence      

MFRARRYRVSLVFAVIFVLIFIHFSRSRDTSASTVSIPAPVDQPKTYPQRPPPAAPDNKK
PIAPESPSSHEPTSELVSTPAQQVEKPAAPDSNPPQDLASGAHGQASSKDVSVAGQTATS
SSDNASAKGDGSEVPPYHLDYHGHARLEADLPETNRPTVHWKQVQEHYPLAPENLIKLPT
GKSKALPKVQAAFRDETTSDKIQRVQRLSTIKAAFEHAWNGYKTSAMGHDEIKPLRGGFR
DPFMGWAATLVDSLDTLWIMDLKDEFAIAVDQVKKIDFTTSKRDEIPVFETVIRYLGGLL
GAYDISGHKYDVLLEKAVELADIVMGAFDTPNRMPTMFYKWTPHDAAKPHLADFDTTLAE
IGSLSVEFTRLAQLTKQDKYYDAIARITNELEKLQDHTMVPGLWPLKIDASGCRTAASQL
NNEVPRNGVVDTEPSALSPTPVHTPAFSASPSMSSASPSTPPVPRSTLTPLLAQNERPLP
TDAQSYAKFFARRDGGSLHIDAEPANYDAPNEGENSAVTSSSGDKACTGGLTASLYPKQK
FGLGARGDSTYEYLPKEYMLLGGLNEQYPAMYKKALNAAREHLLFRPMVKDERDIRFLST
MTLTRPIAEQAPESVSATYEGTHLGCFAGGMFALGAKLFGIEGDLDLAAKLTNACVWAYG
VTKTGIMPEHFLLVPCKKGEPCVWNETDYWNALDPNEEQRIAEAEKAIEQKSKASDSTKR
STTNGIRRRDSSGKWHVIADSAKTDDLINHDEDEVKKQDAKDKAVPHEIFVTQRIMNERL
PPGVTRILNRAYLLRPEAIESVFYMFRITGDNYWREKGWEMFQAVSKYTRTEIAHSAIND
VTLEKSKMQDTMESFWLAETLKYFYLLFADPSVVSLDDYVLNTEAHPLKRPAY

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	214	890	3.5e-176	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	214	890	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.81e-100	138	891	1	519	glycoside hydrolase family 47 protein; Provisional
223021	PHA03247	0.003	32	107	2883	2956	large tegument protein UL36; Provisional
184918	PRK14954	0.005	38	134	382	499	DNA polymerase III subunits gamma and tau; Provisional
236940	PRK11633	0.005	33	90	88	145	cell division protein DedD; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01562.1|GH47	0.0	1	891	1	869
BCS13278.1|GH47	0.0	1	891	1	869
CAK47995.1|GH47	0.0	1	891	1	868
QMW36915.1|GH47	0.0	1	893	1	851
UCK57250.1|GH47	0.0	1	893	1	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	4.92e-47	215	888	13	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	5.57e-47	215	888	18	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	5.81e-47	215	888	18	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.01e-46	170	888	52	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	2.43e-46	215	888	13	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18498|MA1A1_SPOFR	7.15e-47	207	893	197	651	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|A2AJ15|MA1B1_MOUSE	4.01e-45	154	888	160	652	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	4.73e-45	170	888	213	693	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|B2GUY0|MA1B1_RAT	4.26e-44	206	888	206	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|Q8H116|MNS2_ARATH	1.94e-40	206	889	97	536	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984010	0.016019

TMHMM  Annotations     

Start	End
7	24