CAZyme Information: AFUB_077995-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_077995-T-p1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884		97296.14	6.3114

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000006_A_fumigatus_A1163:1687929-1690746(-)

Full Sequence      

MQVKSESSVPVMGNLKTVNATVDEVFDLSRAGTPSSQDESAREDAAPSVQPNFTSLLPQL
TLEEKVGLLSGTDFVHSSGVSRLNIPPLKLVDSVNGVKGSELHHGVPTAIFPSSTLYGAT
WNNTLMEELGRALAYQAKLKSAQVILGPTINIHRDPRGGRNFECFSEDPLLSGQLAAGVV
RGIQSQGVAACPKHFACNESEFKRREYSVAQSHNSRAVREIYLAAFQEMLRRSEPHGLMV
SYNKLNGTHTTEHPFLKEILRDEWAYNGCLVSDWFATKSCAASINAGLDLEMPGPSVLRG
PKLVAAVRDGVVDEKAVDECVSRVLALVEKTRESHSLEPERSEIIPETNALALKIASEGI
VLLKNEQGVLPLDMRRAPKIAVIGVPASEPVVSGGGSASAPPQYLQKPLDYLRDAHPFPS
LVKYIRGVNTNRIIPIVPLDCTTSRNGSPGFDVAYYNEDSDIPVYTEHQKTPVVAMVRNL
KPGLTEPGFSCEISTTITPKTTGPHTLAARVTGSFSLFVESKAVLSVPKQHEVTMEDFLF
EPARLEHRTSVFMEAGKPYLVRLLSRARIPRENDYEPTPHGATLCYEEFSDERAAIAEAV
QAAFSADVSIIFAGRNQQYESEGFDLESMSISEPQVRLIRAVTAVSKKTVLVLNCGNPID
VSPFVNEVDAILNAHFPGQEGGQAIANILTGKTTPSGRLATTWPKKFDEEHVPTYHNFPA
RLTERGYEIKYEEGLQIGYRHPQSQRTAQWQFGHGLSYTTFEYSGLTVSGQKMTEEAGDS
DLKISVRVKNTGIYPGHEVVQLYISPPDSTKVWRPARELKGYAKVWILPGESETVTISLN
KKHAFSYWDEDAKQWRLEPGTYRLLVGPFSTPFEIEHSLVWSGR

Enzyme Prediction     

No EC number prediction in AFUB_077995-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	293	1.8e-59	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.64e-64	31	867	14	751	beta-glucosidase BglX.
224389	BglX	1.11e-63	72	417	47	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.44e-50	55	879	55	775	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	6.60e-43	558	739	43	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.18e-35	81	327	62	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI65540.1|GH3	2.85e-265	47	882	5	833
CZS83194.1|GH3	6.88e-257	55	867	5	812
QKD60029.1|GH3	5.53e-256	57	867	7	812
UQC84261.1|GH3	1.26e-255	52	867	872	1675
CEF85991.1|GH3	2.22e-255	55	867	5	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.45e-137	56	883	9	844	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.97e-133	56	883	9	844	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.80e-124	52	879	4	666	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.95e-110	60	870	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.64e-93	56	876	7	708	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	6.73e-155	50	883	11	863	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|P27034|BGLS_RHIRD	7.26e-155	56	866	5	795	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	2.13e-152	49	883	2	837	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	9.27e-151	57	883	10	838	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.30e-150	57	883	10	838	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AFUB_077995-T-p1.