CAZyme Information: AFUB_073450-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_073450-T-p1
• CAZy Family: GH55
• CAZyme Description: Ortholog(s) have cellulase activity and role in xyloglucan catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	scf_000006_A_fumigatus_A1163|CGC11	33430.73	4.6149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000006_A_fumigatus_A1163:353896-355128(-)

Full Sequence      

MKFGSIVLIAAAAGFAVAAPAKRASGKEFIFPDPSTISTLIGKGMNIFRIQFLMERLVPS
SMTGSYNEEYLANLTSVVDAVTKAGSYAILDPHNFGRYNGQIISSTDDFKTFWQNLAGKF
KSNNLVIFDTNNEYHDMDQTLVLNLNQAAINGIRAAGATSQYIFVEGNSWTGAWTWADVN
DNLKALTDPQDKIVYEMHQYLDSDGSGTAESCVSTTIGKERVSAATKWLKDNGKVGIIGE
FAGGVNDQCRTAISGMLEYLAQNTDVWKGALWWAAGPWWGNYMFNMEPPSGAAYVGMLDI
LEPYLG

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	21	283	9.8e-105	0.9432624113475178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.34e-75	30	276	23	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.84e-17	43	282	85	366	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAB62319.1|GH5_5	1.58e-177	1	305	1	332
BCS06954.1|GH5_5	1.58e-177	1	305	1	332
AAG50051.1|GH5_5|3.2.1.4	1.84e-176	1	305	1	332
AAE84292.1|GH5_5	1.02e-175	1	305	1	331
AAE60102.1|GH5_5	1.02e-175	1	305	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I77_A	8.32e-176	26	305	23	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	7.34e-175	26	305	25	304	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	7.61e-175	26	305	26	305	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
1GZJ_A	4.29e-160	26	305	25	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	8.53e-158	26	305	26	305	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DME8|EGLB_NEOFI	1.31e-219	1	306	1	329	Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	2.81e-178	1	305	1	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|A2QPC3|EGLB_ASPNC	1.82e-176	1	305	1	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglB PE=3 SV=1
sp|O74706|EGLB_ASPNG	1.82e-176	1	305	1	331	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1
sp|B8MW97|EGLB_ASPFN	1.13e-168	26	306	53	333	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999731	CS pos: 18-19. Pr: 0.9673

TMHMM  Annotations     

There is no transmembrane helices in AFUB_073450-T-p1.