CAZyme Information: AFUB_070450-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_070450-T-p1
• CAZy Family: GH5
• CAZyme Description: Ortholog(s) have trehalase activity and role in cellular response to starvation, asexual sporulation resulting in formation of a cellular spore, trehalose catabolic process, cellular response to heat

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	scf_000005_A_fumigatus_A1163|CGC8	89816.49	6.6172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000005_A_fumigatus_A1163:2102997-2106281(-)

Full Sequence      

MHRRSTLVELYTTVRVRNQPISTHFPPILRSDLWIAQCFPPRSTLSFLRPSSVVTNNQSV
WPIRHQRTNSLDPFSDPDIYYGDEDSLARIRDRRRAFSSHSTAKIFRIFWAEYLPGEVAM
FLIDVDATLQSLLEREDTDRNMQITIEDAGPKVLSVGTAASSGYNRFDVRGTYMLSNLLQ
ELTIAKDYGRKHIILDEARLSENPVARLSRLIKNSFWDALTRRIDGSNIEVAGRDPKDWT
EDPRPRIYVPHGAPEQFEYYKGIAKEHPELRLDVQMLEENITPDYVRDLNSKPGLLALAM
QKKYNESTQKTECVGVPFVVPGGRFNELYGWDSYMESLGLLVSNRVDLAKAMVINFCFCI
KHYGKILNANRSYYLTRSQPPFLTDMALRVYERIKNEPDAMDFLRNATLAAIKEYYSVWT
AAPRYDELSGLSRYRPEGRGVPPETEPTHFTHILTPYAEKHGMTFKEFVQAYNEGRVQEP
ELDEYFLHDRAVRESGHDTSYRLERVCANLATVDLNSLLYKYEVDIARIIRTYFKDRLEI
PPEFRTESTKDIESESSSVWDRRARRRKVRMDTYLWDEEKGMYFDYDTVLQKRTTYESAT
TFWAMWAGLATPHQAAELVRKALPRFEVYGGLVSGTEESRGAVGLDRPNRQWDYPYGWAP
QQMLAWTGLLRYGYQEEAERLAYKWLFMITKAFVDFNGVVVEKYDVTRPIDPHRVDAEYG
NQGVDFKGAPREGFGWVNASYVYGLEFLNAHQRRALGAITPWETYSKAIAVQDAY

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	188	746	2.6e-154	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224541	TreA	0.0	113	754	1	558	Neutral trehalase [Carbohydrate transport and metabolism].
395961	Trehalase	0.0	186	749	1	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	2.44e-48	317	738	142	534	alpha,alpha-trehalase
183934	treF	2.09e-43	317	738	161	536	alpha,alpha-trehalase TreF.
183936	treA	1.89e-40	317	738	150	526	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43979.1|GH37|3.2.1.28	0.0	64	773	7	728
BCS08564.1|GH37	0.0	64	773	7	728
BAE54706.1|GH37	0.0	65	773	8	728
QMW36943.1|GH37	0.0	65	773	8	728
QMW24943.1|GH37	0.0	65	773	8	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	4.61e-292	51	773	2	745	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	2.22e-291	46	773	2	750	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5NIS_A	1.67e-290	124	773	6	650	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5M4A_A	9.67e-264	174	773	3	597	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	6.03e-34	317	738	115	492	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42777|TREB_EMENI	0.0	65	774	20	742	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2
sp|A0A384JRP0|TREA_BOTFB	0.0	62	769	4	725	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|J5K1E2|TREA_BEAB2	0.0	57	769	2	731	Cytosolic neutral trehalase OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=NTH1 PE=1 SV=1
sp|O42622|TREB_MAGO7	0.0	66	769	8	724	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|O42783|TREB_NEUCR	0.0	64	769	13	732	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AFUB_070450-T-p1.