CAZyme Information: AFUB_068310-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_068310-T-p1
• CAZy Family: GH47
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring hexosyl groups activity, role in GPI anchor biosynthetic process and endoplasmic reticulum membrane, integral to membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		51435.68	9.6793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000005_A_fumigatus_A1163:1512976-1514512(+)

Full Sequence      

MSRMTVLSPSAGSQSACSLGLILVNPRRPLRSLSILFGLWKALIFLVIVICPGLGYDTST
SLLLYPTRDLSDVDPLHFPLSLRFVRWDSIYFVHAAEHGYVFEQEWAFGYGYTRLLALLA
SVFPRSASLGDSARIGLVAVVLSHIAHYLSVLVLYRLSVNIFGGDTAKQKTLCFLSAALH
IISPAGAFLSAPYGEALFSLLNISGLYLYSSSVLDAATNHRLSRDLKLLAAAVLISAATA
VRSNGILGGVLFAYDALLQLPQILSRGLSLAVVSRLAVIVLGGCVIALGMAVPQYIAFNA
FCMTSNAPRPWCGWTIPSIYRFVQEKYWNVGFLRYWVVPNIPLFLLAMPILALLLRSAFW
AWRLPSVTSKFSENGANGALTKAMWLLPRLAIIQALLAVLAFTSYHVQIINRLSSGYPLW
YWYLAAELISDFKNSQSTNKCISISAVAVQAIMIYGLIHAVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in AFUB_068310-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	36	470	3.9e-112	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.41e-40	33	470	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.51e-20	79	470	69	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01167.1|GT76	6.84e-176	23	470	15	469
BCS12914.1|GT76	6.84e-176	23	470	15	469
CAK38795.1|GT76	1.89e-172	23	470	15	466
QMW40534.1|GT76	3.10e-170	23	470	12	452
BCR82784.1|GT76	4.86e-170	23	470	14	465

PDB Hits     

AFUB_068310-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WQ21|GPI18_ASPFU	4.03e-307	1	470	1	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	5.98e-161	23	470	12	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	5.10e-88	29	470	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	7.92e-87	28	470	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.12e-50	32	470	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999955	0.000056

TMHMM  Annotations     

Start	End
34	56
137	159
172	194
276	298
332	354
385	407
441	463