CAZyme Information: AFUB_063940-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_063940-T-p1
• CAZy Family: GH43
• CAZyme Description: Protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	scf_000005_A_fumigatus_A1163|CGC10	47156.65	6.5831

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000005_A_fumigatus_A1163:319262-320734(-)

Full Sequence      

MLLPKGGVTWKSAKARLPPWRAVVVLLTRPRFLISLALTGILILLWRGISKSASGMQNFY
CYGPPKSPMEMTINEMNAWMAHTQTPVIFNHHEPYVVNDSSIINVDLNGIQSTRAAKENK
ERVLILTPLRDAAPHLEKYFDLLYNITYPHELIDLAFLVGDSQDDTLAVLARELKRIQDQ
VEDKIAFRSATIIQKEFGAETGMNVEDRHSFAAQGPRRKAIARARNYLLYSALKPDHSWV
YWRDVDIVDSPPTILEDFISHNRDILVPNIWFHRYKDGRDIEGRFDYNSWIESDKGRRLR
QTLDPDTILAEGYKEYDTGREYLVGMGDWRKNKDEEVELDGIGGVNILVKADVHRSGINF
PPYAFENQAETEGFARMAKRAGYEVYGLPNYIVWHIDTEEKPGNLGDRKAY

Enzyme Prediction     

No EC number prediction in AFUB_063940-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	100	363	1.9e-108	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	5.99e-156	101	364	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12574.1|GT62	3.71e-264	1	411	1	411
BCS00814.1|GT62	3.71e-264	1	411	1	411
CAK38583.1|GT62	2.14e-263	1	411	1	411
BAE59398.1|GT62	5.91e-263	1	411	1	410
QRD86028.1|GT62	5.91e-263	1	411	1	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	9.12e-69	99	399	3	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	9.92e-98	99	396	74	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	8.61e-96	88	396	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	1.89e-79	99	396	169	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.89e-75	100	396	74	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P39107|MNN9_YEAST	1.66e-70	88	399	82	393	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000008

TMHMM  Annotations     

There is no transmembrane helices in AFUB_063940-T-p1.