CAZyme Information: AFUB_057770-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_057770-T-p1
• CAZy Family: GH33
• CAZyme Description: Protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	scf_000004_A_fumigatus_A1163|CGC24	41355.39	7.9011

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000004_A_fumigatus_A1163:2511865-2513188(-)

Full Sequence      

MKTAVLSLFLALQTYARVTGSPSGFAAGTTGGGSATPAAPSSLDELVQWITDDKPRVILI
DRTWDFIGTEGTTTGKCCSMPSTTVCSGGTSKGQAWIQDHCDGGSWVSCKYDNAALTPLD
VGSNKSIVGVGNKGVIKGKGLRVRNGNKNVIIQNIHITNLNPQYVWGGDAITLDNADKVW
IDHNKISLIGRQFIVSGWGKAGHVTISNNEFDGRTSWSAGCNGKHYWTLLLLGEQDYYTF
QGNWLHDVSGRAPHMGTDHTKSQIFFHGVNNYFQNVGGHAFDVDTNTWVLLEGNYFENVN
TPLTDTSLRAGGKLYTTSTVAAAGACQDKLGYICEWNRLAGSGAWKDRTDADVKTKAAAF
KSSLVGHYPVADVPAKVVANAGVGKL

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	109	298	1e-86	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.12e-42	107	300	2	190	Amb_all domain.
226384	PelB	1.31e-20	114	386	92	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.89e-18	112	296	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
404168	Beta_helix	0.005	136	294	21	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD64891.1|PL1_4	8.35e-208	7	386	11	391
QMW47813.1|PL1_4	4.81e-207	7	386	11	391
QRD93342.1|PL1_4	4.81e-207	7	386	11	391
QMW35751.1|PL1_4	4.81e-207	7	386	11	391
BCS20248.1|PL1_4	6.86e-206	1	386	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	3.46e-94	16	385	1	359	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.42e-90	18	386	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	8.00e-90	18	386	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	3.52e-12	124	305	80	255	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	7.89e-08	103	296	60	276	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y0L8|PELF_ASPFC	1.26e-295	1	386	1	386	Probable pectin lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelE PE=3 SV=1
sp|A1DEH0|PELF_NEOFI	8.40e-285	1	386	1	386	Probable pectin lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelF PE=3 SV=1
sp|Q0CFF7|PELF1_ASPTN	1.03e-219	1	386	1	388	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	8.79e-113	18	386	23	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5B3J8|PELF_EMENI	4.89e-111	16	386	20	378	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999723	CS pos: 20-21. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in AFUB_057770-T-p1.