CAZyme Information: AFUB_054750-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_054750-T-p1
• CAZy Family: GH31
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	scf_000004_A_fumigatus_A1163|CGC2	92195.81	5.0913

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000004_A_fumigatus_A1163:1690570-1693251(+)

Full Sequence      

MVQLDVEKTIEELTLGEKVALTAGIDFWHTAAVPRLNIPSLRMSDGPNGVRGTRFFNGVP
AACFPCATALGATWDTKLLYEVGRLMGEESIAKGAHVVLGPTINTQRSPLGGRGFESFAE
DGVLSGILAGHYCKGLQETGVAATLKHFVCNDQEHERLAVDSIVTMRAMREIYLLPFQLA
MRICKTACVMTAYNKVNGTHVSENKQIITDILRKEWGWDGLVMSDWFGTYSTCDAINAGL
DLEMPGPTRWRGTALAHAVSSNKAFEFVMDERVRNILNLHNFVEPLGIPENAPEKALNRP
EDQALLRRAAAESVVLMKNQDNILPLKKEKPILVIGPNAKTAAYCGGGSASLDAYYTVTP
FEGVAAQSQGEVTFSQGVYSYKELPLLGPLLKTDDGKKGFKFRVYNEPPSEPNRQLIDEL
HLESSSGFLMDYKHPKIKTFTFYVDMEGYFTPEEDGIYDFGVTVVGTGKLFVDDELVVDN
SKNQRQGTAMFGNATVEEKGSKELKAGQTYKVVLQFGTAPTSDLDMRGVVIFGPGGFRFG
AARRVSQEELISKAAELASQASQVVIFAGLTSEWETEGYDRDHMDLPPGSDEMISRVLDA
NPDTVVVIQSGTPVTMPWAHKAKALLQAWFGGNECGNGIADVLYGNVNPAAKLPLSFPVR
LQDNPSYLNFRSERGRVLYGEDIYVGYRYYEKVDLAPLFPFGHGLSYTTFSRSDLSLATT
PEKPQLEDGEPITVTVSVTNTGSVAGAEIVQLWVAPPPTGVNRPVRELKGFTKVFLQPGE
TKKVEIVVEKKLATSWWDEQREKWASEKGTYEVLVTGTGDEVLKSSFEVEKTRYWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	245	1.7e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.01e-80	35	828	101	763	beta-glucosidase BglX.
224389	BglX	3.95e-75	1	340	10	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.92e-52	314	707	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.28e-43	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	9.96e-39	13	789	60	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA36818.1|GH3	0.0	1	838	1	838
BAE61980.1|GH3	0.0	1	838	1	839
QMW44618.1|GH3	0.0	1	838	1	839
QMW32588.1|GH3	0.0	1	838	1	839
QRD84089.1|GH3	0.0	1	838	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.61e-279	1	838	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.78e-273	3	838	3	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.09e-157	4	832	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.16e-116	9	815	8	648	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.39e-102	10	829	58	826	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	0.0	1	838	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	0.0	1	838	9	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	0.0	1	838	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A2R989|BGLI_ASPNC	0.0	23	838	2	818	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	1	838	1	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998518	0.001491

TMHMM  Annotations     

There is no transmembrane helices in AFUB_054750-T-p1.