CAZyme Information: AFUB_054400-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_054400-T-p1
• CAZy Family: GH3
• CAZyme Description: Has domain(s) with predicted chitinase, cation binding, chitin binding activity and role in cell wall macromolecule catabolic process, chitin catabolic process, carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1225	scf_000004_A_fumigatus_A1163|CGC17	131189.36	4.8343

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000004_A_fumigatus_A1163:1585487-1589611(-)

Full Sequence      

MRPSFVLRASLMGLASAVTESYNGQYVDDCPRLCADAGPSPANWTHLHHLRNLERCDQTV
LFGMNVHSSVADPNTILTIRACVASQGQTYEPAAPPDVPQQQRPRNLAVAENCGAKAIQT
AFTPHVGPSTLLKASGAAPQSADVAEAARQLALFVGQSAECGATILFAKHKSAVVGLYSG
AQITKHAAQGVLDSYAGKQTSVLQICQPASAALTVGVVSTGTTPATAVSMDVLVPTMDTG
FNATRAGHGNLTASSRAGTMLDVRPQPQPDGTCNTYTVKDDDGCWALAQAYHLQEKDIED
FNKNTWGWAGCGNLQSGQLICLSKGNPPMPAPIPDAICGPQVPGTQRPSNGTALADLNPC
PLNACCDVWGFCGTTADFCTETPADTGAPGTAKPDTNGCISNCGMEIVNNGNAPAQVKTI
GYFEAFDQLRACLRMSVDEIPAQKYSHVHFAFATVTPGFDVDTSSVEDEFRRFVKRTGFK
KILSFGGWAFSTDPSTFQRFRDATKPEHRDTFVTNLVSFMSRHNLDGFDFDWEYPGAPDI
PDITPGSPDEGQNYLAFLQRLRSKLPSGKSLSIALPASYWYLKQYPVKQMAKYVDYFIYM
TYDLHGQWDVDNQWAIPGCPAGNCLRSHVNKTETHDALVMITKAGVEARQLVVGVTSYGR
SFRMNDASCSGPFCTYAGDRTHSMASAAPCTATGGYIANAEIHDILQSHGNYSIVKAYVD
KESDSNILLYGNPGAVDWVAYMDGAVKARRIDWIKSLNFGGSTDWAIDLQAYSDNENGDD
SDDGDGDGADDEAGDDIPTCRADQNPGALDGLADTADSLDPGCVNLFAMDILYAQLLDSL
SLFQTNSQDYDDKFGWYEKWTKEQIQPRIDDFMKLGEGAGLKYFDCYWAYTGRDETKDSC
LGMPHIWDTSAGWTIRFDLVDNQGFFDALAAETGIDASWVTFGDETSDYVCADPGDVRPG
LGHVPCRKLYCQKLNYPQKASDDAIHVGNPKKLIEASLGNVTALRTSLLSSYLSVGLSFY
DDGPNDGAASDAVVAYSMPVLQLAEAVSSMKDIKDIGEKAKEEAKKQLIFKILSIVFMVL
PFVGEALGPLIGSAASIARIALLIGEAGNGALTVADIIEDPSSAPFAILGLIAGVGSGTG
KLSKGEALADASKARGLLKASDLAKFPQRFRDQDALVQKIVKSLCARKAGSAIGLGVINP
PKTLTHYSSISAGQAGRGMSTTSSK

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	417	774	9.6e-56	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	0.0	418	770	1	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	4.68e-61	418	769	1	333	Glyco_18 domain.
395573	Glyco_hydro_18	3.09e-52	418	768	1	305	Glycosyl hydrolases family 18.
119365	GH18_chitinase	2.13e-45	438	663	19	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	1.16e-42	420	604	2	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE60282.1|CBM18|CBM50|GH18	0.0	1	1187	1	1213
QKX54053.1|CBM18|CBM50|GH18	0.0	33	1188	4	1239
QGA13088.1|CBM18|CBM50|GH18	0.0	1	1187	31	1294
QMW30533.1|GH18	0.0	405	1179	1	772
QRD89398.1|GH18	0.0	405	1179	1	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	3.54e-28	434	772	22	352	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	3.84e-27	434	772	22	352	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
3W4R_A	8.09e-27	408	772	16	379	Crystal structure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]
3WL1_A	9.67e-27	415	772	5	361	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3FXY_A	1.75e-26	422	773	6	347	Acidic Mammalian Chinase, Catalytic Domain [Homo sapiens],3FXY_B Acidic Mammalian Chinase, Catalytic Domain [Homo sapiens],3FXY_C Acidic Mammalian Chinase, Catalytic Domain [Homo sapiens],3FXY_D Acidic Mammalian Chinase, Catalytic Domain [Homo sapiens],3FY1_A The Acidic Mammalian Chitinase catalytic domain in complex with methylallosamidin [Homo sapiens],3FY1_B The Acidic Mammalian Chitinase catalytic domain in complex with methylallosamidin [Homo sapiens],3RM4_A AMCase in complex with Compound 1 [Homo sapiens],3RM4_B AMCase in complex with Compound 1 [Homo sapiens],3RM8_A AMCase in complex with Compound 2 [Homo sapiens],3RM8_B AMCase in complex with Compound 2 [Homo sapiens],3RM9_A AMCase in complex with Compound 3 [Homo sapiens],3RM9_B AMCase in complex with Compound 3 [Homo sapiens],3RME_A AMCase in complex with Compound 5 [Homo sapiens],3RME_B AMCase in complex with Compound 5 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	5.22e-106	258	894	238	829	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	2.16e-29	404	773	9	368	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|P36362|CHIT_MANSE	5.54e-26	434	772	41	377	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q9BZP6|CHIA_HUMAN	1.98e-25	404	773	9	368	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
sp|Q6RY07|CHIA_RAT	1.96e-24	404	773	9	368	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.436990	0.563006	CS pos: 17-18. Pr: 0.5124

TMHMM  Annotations     

There is no transmembrane helices in AFUB_054400-T-p1.