CAZyme Information: AFUB_049020-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_049020-T-p1
• CAZy Family: GH28
• CAZyme Description: Has domain(s) with predicted cation binding, hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	scf_000004_A_fumigatus_A1163|CGC8	57484.80	5.9288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000004_A_fumigatus_A1163:83402-84961(-)

Full Sequence      

MLFVSITAALLLAVLDTLPAGMQAQDAEGWYKAHPGMARISQVNQDTHQIVDEFGRTRFF
HGTNVVMKEPPWYRPFEWAPGVSSFGEQDVQNLHALGLNIVRLGHSWAGAEPVRGQYNQT
FLDIMKKQTKLAEDYGLYVLVDVHQDVLARQFCGHGVPDVSRMRGPVGTAATDMAVQWFV
KEDWVPGWKMYPFPLKPTPFPVDNKGFPSPQSLCGTVDWSLSYTSAAVCNAFGRLDNNYD
GLGDAFAAYWKKLASEYVETTNVVGYNLLNEPWVGDSMADPTLLVPGVADHKVLEGLWNR
AAKQIRTVDNDTLIWFEGATIDILSGFNNVPLGDGSKSVHSFHYYSPPQLSSISTTLNNR
RKDNERLRTAGVLTELTFWMGENQQMQGLADAMSATDAHMVSWIGWAYENLYNSTSGQPY
PELAKHYSRGYPAAVAGTPNSFSFDENSGTFKLQFTSDPNIKAPTEIILPPSTFPNGYKV
QVSPDGSVLQYVPNKRTLALFTSSSIKNTINISATVSPR

Enzyme Prediction     

No EC number prediction in AFUB_049020-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	59	408	5.7e-127	0.9969135802469136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	5.01e-20	429	513	1	85	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
396834	Glyco_hydro_42	2.17e-06	73	150	2	86	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
395098	Cellulase	2.41e-05	66	408	13	268	Cellulase (glycosyl hydrolase family 5).
224786	GanA	0.001	73	141	22	86	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW30510.1|GH5_27	0.0	1	516	3	500
QMW42568.1|GH5_27	0.0	1	516	3	500
UDD59314.1|GH5_27	0.0	1	516	3	500
BAE60253.1|GH5_27	0.0	1	516	3	500
QRD89368.1|GH5_27	3.14e-306	1	499	3	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CCU_A	1.80e-25	35	512	36	474	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	5.89e-25	35	512	36	474	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
2OSW_A	7.78e-23	52	518	39	479	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	3.38e-22	52	518	39	479	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
6JYZ_A	1.33e-12	36	408	18	362	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9GV16|EGCSE_CYANO	7.92e-82	40	488	31	473	Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	2.00e-78	43	510	25	478	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	1.58e-24	40	512	33	466	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000190	0.999780	CS pos: 24-25. Pr: 0.9675

TMHMM  Annotations     

There is no transmembrane helices in AFUB_049020-T-p1.