CAZyme Information: AFUB_048980-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_048980-T-p1
• CAZy Family: GH28
• CAZyme Description: Protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	scf_000004_A_fumigatus_A1163|CGC12	52188.77	5.8919

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000004_A_fumigatus_A1163:73972-75342(-)

Full Sequence      

MSSALGSHLLADVTKRKAARSARVASWDQSGLNEDAFVVLPGETAVLADLQGPGAITHLW
FVQTCRKILGPGLIPYTKSGVAMMEIHNALGLNFEVNDPDYYRKVLIKMYWDESESPNVL
APIGDFFCLGHSMAANFQSLPFTVSVKPSEEKQYGGAAAFNCYLTMPFNKRARIEIENQN
DEAYIQYFYIDYELYAEPLPKDTLFFHAHWRRENPTNGWAPSCIQTNSLETQVKNLDGKS
NYVILETEGAGQYIGCNHSVWHEQGTWWGEGDDMIFIDDDTWPPSMHGTGGEDYFSQGWG
MQKNAYPFCGTIIHEDDVPNTQVSYRWHLADPVRFSRKIKVTMESGHANHLRDDWSTTAY
WYQTLPGPKLDILPVEKRLPRRPAVPPIPEPSEREIAALSAEKKEKLAQHRERYEAFVKD
RNDWLERRAKDTKQRALNNVWICEDIRQRFLTSLRE

Enzyme Prediction     

No EC number prediction in AFUB_048980-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	102	363	2.2e-79	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	3.03e-113	103	363	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59927.1|GH172	5.58e-305	1	454	1	455
CAP93243.1|GH172	1.22e-292	5	454	3	452
CAK39208.1|GH172	2.20e-292	5	454	3	452
UPK94269.1|GH172	3.66e-283	2	455	4	457
QKD59092.1|GH172	2.63e-279	3	455	6	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	5.97e-157	9	390	7	387	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	8.84e-52	12	363	11	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

AFUB_048980-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AFUB_048980-T-p1.