CAZyme Information: AFUB_046830-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_046830-T-p1
• CAZy Family: GH20
• CAZyme Description: Ortholog(s) have role in oxidation-reduction process, conidiophore development and intracellular localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646		72180.90	7.4006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000003_A_fumigatus_A1163:3719393-3721810(+)

Full Sequence      

MKLQVDLDPLLKLGDQTSKTDRSAAWARLAMRKIGGTSGCVVAGRLAENPDIKILVIEAG
QHNRDLENVHMAGGWSNNFDSETDWNLITKPMPGVDNRQVKLSRGRFLGGSSGCNGTLCI
RGAKQDYDDWELEGWSGEEFFAAMRKAETFHTKPWFKADENSHGYSGPLHTEPHDLAPIA
NLLMDSFVSQGLPLHHDMFSTGDIPHGCGHVPRTVYKGIRTTAADYITKEYHRNNVTIQT
DTTVDRVVLEQGPDGLRATSVITQLADGTPRTFHARKEIIVSGGAYCSPAILMRSGIGAR
AELDQHGIPCQVDLPGVGKNLLDHLIVFMFYETEKEGLTNDFHVYHDNNFAKTYQQWKEH
KSGFLSTFPFGCFAFARLDDRLKDEPLWRDAPRQPGRDPMGLTPKQPNIEFFTTECYGGP
KQYNQFPVDKKHAFSMIAELFAPKSRGTVTLKSKDPKENPVIDCNYLSDPLDLLVLTEAC
RFGNEIVMNGAGTKDIVKGSWPPNLKHHTYKTREEWIPYVKEHATTCYHAAGTCAMGKDG
DSMAVLDNKLRVRGVAGLRVADCSVMPTLHGGHTQMPAYGIGERCADFIKETCFRFFAKK
EVNCCRIEKKLDDLQSHALPLSYQSWSGQSGKYCAISFKNREQRKL

Enzyme Prediction     

No EC number prediction in AFUB_046830-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	591	3.4e-156	0.9806338028169014

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.54e-99	35	590	13	532	choline dehydrogenase; Validated
225186	BetA	3.33e-95	35	591	15	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.71e-62	35	589	8	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	3.84e-40	443	585	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.66e-33	95	326	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48130.1|AA3_2	0.0	35	592	16	573
QMW36070.1|AA3_2	0.0	35	592	16	573
UDD65288.1|AA3_2	0.0	35	592	16	573
QRD92967.1|AA3_2	0.0	35	592	16	582
AFB81353.1|AA3_2	0.0	35	591	18	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.82e-69	35	590	14	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.53e-69	35	590	14	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.52e-69	35	590	14	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	1.65e-55	35	592	48	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3LJP_A	2.16e-55	35	590	21	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	2.95e-73	35	590	12	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	2.32e-67	36	589	15	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q66D54|BETA_YERPS	7.70e-66	36	590	11	532	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	7.70e-66	36	590	11	532	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q39A44|BETA_BURL3	5.44e-65	36	590	14	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AFUB_046830-T-p1.