CAZyme Information: AFUB_041840-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_041840-T-p1
• CAZy Family: PL38
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring glycosyl groups activity and membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	scf_000003_A_fumigatus_A1163|CGC14	50972.44	6.9081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000003_A_fumigatus_A1163:2233969-2235369(+)

Full Sequence      

MLIPLRYRRRITLISAVLGLFLIYHFISIRPNLPRPLSTVRSNLQQQRQQPKQKPDIHSD
CPLLPGIEDVLVIMKTGVTEALDKVPVHFETTLRCIPNYVIFSDFEEEIAGVRIHDALRN
MDPEVKRTVPDFDLYNRLQKLGRKGLGTQDFADEANSAIGKPNNPGWKLDKWKFLPMVQE
TLRHKNDAKWYVFMEADTYFAWPTLLEWLSNYDPQKPLYIGTETQIADVIFAHGGSGFII
SRPALQLAADEYAARRVELDMFTDEHWAGDCVLGKVLLDAGVPLTYSWPILQNSNIRELD
PFTAGFYRQPWCFPTVAFHHLSSQDIRNLWEFEQRRWKSHKRLLLHSDVFKELIYPELSN
VRDGWDNLSGDEHVSVNTFQECQSICLNDSTCVQFALRAGSCFTSKTPRLGVESTAVRSG
WVMKRIERMMESAPSCPKPDFGL

Enzyme Prediction     

No EC number prediction in AFUB_041840-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	6.92e-07	187	287	84	198	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	1.21e-05	187	325	210	346	hypothetical protein; Provisional
238531	PAN_AP_plant	0.003	374	408	29	65	Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions. S-receptor protein kinases and S-locus glycoproteins are involved in sporophytic self-incompatibility response in Brassica, one of probably many molecular mechanisms, by which hermaphrodite flowering plants avoid self-fertilization.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06698.1|GT31	4.89e-224	9	443	7	439
BCR94088.1|GT31	4.89e-224	9	443	7	439
CAK47765.1|GT31	1.08e-223	9	443	7	451
QRD94340.1|GT31	8.90e-222	4	442	3	426
BAE63422.1|GT31	8.90e-222	4	442	3	426

PDB Hits     

AFUB_041840-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NS00|C1GLT_HUMAN	1.26e-06	158	366	131	355	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

Start	End
12	29