CAZyme Information: AFUB_034250-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_034250-T-p1
• CAZy Family: GH154
• CAZyme Description: Ortholog(s) have chitosan binding activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	scf_000003_A_fumigatus_A1163|CGC14	35169.16	4.5174

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000003_A_fumigatus_A1163:109094-110315(+)

Full Sequence      

MPSTTIIRQLAISLALCNSALGQVVNGADYNKPNGGPPASFFAAASTMPVAALQAAAAKA
TKVPSLATYPVSQDKGAAKSTIHTDWASFSEGASISWVADMDVDCDGLNSGCQGNPDGQP
QTNWGALSAYEVPFIVIPDKYLSANSGALPGNNIAAVICNGKMFYGILGDSNGDSPQVTG
EASWLMARTCFPNEGLNGNNGHTGVDVTYIVFTGKNAVLPSSALTKNYITNFTTLRSMGD
KLVNALVSNLGLSGTPPTKTTTRVTTTTTKPTSTASCSWAGHCLGASCSSDDDCADALVC
TAGKCSVDGAATCSWEGHCEGASCSSNDDCSDDLYCKSGSCTAP

Enzyme Prediction     

EC	3.2.1.132:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	48	245	1.7e-77	0.990909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.71e-60	101	245	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD61138.1|GH75	9.07e-152	1	311	1	310
QRD84969.1|GH75	6.70e-151	1	311	1	310
BAD08218.2|GH75|3.2.1.132	6.70e-151	1	311	1	310
UDD61137.1|GH75	6.70e-151	1	311	1	310
BAE63124.1|GH75	4.65e-146	1	311	1	319

PDB Hits     

AFUB_034250-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75R32|CSNC_ASPOZ	1.19e-151	1	311	1	310	Endo-chitosanase C OS=Aspergillus oryzae OX=5062 GN=csnC PE=1 SV=2
sp|Q2U5P1|CSNC_ASPOR	8.26e-147	1	311	1	319	Endo-chitosanase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnC PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	8.43e-23	99	246	77	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	8.43e-23	99	246	77	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q8NK76|CSNB_ASPOZ	2.02e-22	101	246	78	238	Endo-chitosanase B OS=Aspergillus oryzae OX=5062 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000593	0.999351	CS pos: 22-23. Pr: 0.9651

TMHMM  Annotations     

There is no transmembrane helices in AFUB_034250-T-p1.