CAZyme Information: AFUB_030560-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_030560-T-p1
• CAZy Family: GH132
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring hexosyl groups activity and integral to membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	scf_000002_A_fumigatus_A1163|CGC35	53690.35	9.2720

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000002_A_fumigatus_A1163:3902202-3903718(-)

Full Sequence      

MSLSRSPSPHPGGGWSSPGLTPGSGTSTPRSGFLSPNSLGPSGISWAAARAKSEEVRGYP
SFSTRNNGFFSRSKRKITSSLPRFRMNGSARYGYVDKDEYWRGQNYSGTGLRFGFARGLM
RRRRSRAILALIVLSLGYLFFWTAIVQSYRRSSFGGGRKFVIILPSNVEGGVMEWKGARE
WAIERNSISNKEEYAKRWGYELEIVNMLAKKRYSHEWRESWEKVDIIRDAMRKYPNAEWF
WWLDLNTWIMEYSYSLQDQIFDRLGDLTYRDINLYNPLNISHPPTAPYLDELSRSAEGDG
NPSSIDLLLSQDCGGFNLGSFFIKRSLWSDRLLDLWWDPVMYEQKHMDWEHKEQDALEYL
YQSQPWIRSNVAFTPQRYINSFPPGACGEGDDPDVHYSEKDRDFLVNMAGCQFGRDCWGE
MYQFRELSKKLNRTRWQRLKDGLGELYSRLLPKEDKSQEQQQ

Enzyme Prediction     

No EC number prediction in AFUB_030560-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	159	419	2.3e-86	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	6.22e-83	159	417	4	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	3.44e-06	190	360	156	304	glycosyltransferase; Provisional
215617	PLN03182	0.002	187	336	152	265	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89754.1|GT34	1.85e-246	1	457	1	460
QMW42907.1|GT34	1.85e-246	1	457	1	460
QMW30853.1|GT34	1.85e-246	1	457	1	460
UDD59694.1|GT34	1.85e-246	1	457	1	460
CAK42408.1|GT34	2.00e-245	1	459	1	461

PDB Hits     

AFUB_030560-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	3.80e-113	150	438	112	389	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	4.96e-93	161	439	76	343	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	1.62e-26	185	417	125	339	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	3.64e-25	159	436	103	358	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	2.30e-24	188	426	112	329	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999889	0.000141

TMHMM  Annotations     

Start	End
127	149