CAZyme Information: AFUB_030040-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_030040-T-p1
• CAZy Family: GH13
• CAZyme Description: Ortholog(s) have triglyceride lipase, cutinase activity and role in triglyceride catabolic process, cellular carbohydrate catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		35677.32	9.4034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000002_A_fumigatus_A1163:3747128-3748228(-)

Full Sequence      

MKISATAVVLLAGLAAGAPTKTIQSKFEKRQFGTGTDGLGALASLFPTLGGGGSSTSSGL
GALASLIPGLGGSSSGSGFSLPGFTLPTSIPGLGSLGSLGSSGSSGASGLSGLSGLGGLS
GLNGLGSSTTGSSAEASTSGTAATSSNSNSGGALFGLLGGEFPLFPRQPSRLLRYSDHVA
KRGLLGSMTENGVKNKDACQPLTFIFARGTSELGNMGSVVGPPVATKLRSLLNNKVVVQG
VDYPASVEGNALLGAAGGPTMASMVKQALSQCPDTKVVVGGYSQGAMVVHNAANSLSQGQ
IAAAVLFGDPFKSQAVGKVDKANVKEYCAAGDPVCLNGANVIAHLSYGSDAAEAAQFLVT
ASGVKA

Enzyme Prediction     

No EC number prediction in AFUB_030040-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	198	360	6.2e-43	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.11e-45	198	359	1	170	Cutinase.
223477	YpfH	3.86e-04	253	366	75	179	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89623.1|CE5	2.07e-86	189	364	103	278
QQK39777.1|CE5	1.67e-82	185	363	97	275
CAP91879.1|CE5	4.05e-81	186	363	144	321
BAE58644.1|CE5	1.60e-78	190	364	36	210
QRD85183.1|CE5	2.12e-78	187	364	150	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	2.63e-35	187	359	72	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	2.08e-28	199	363	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	1.63e-27	199	360	12	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	2.13e-22	179	358	5	194	Chain A, cutinase [Malbranchea cinnamomea]
5AJH_A	1.34e-20	182	359	14	206	Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_B Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_C Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	5.65e-77	184	364	45	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	1.35e-39	198	364	30	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	5.40e-37	187	358	72	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	1.61e-36	198	363	30	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|G0RH85|CUTI1_HYPJQ	1.16e-34	187	359	72	244	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002235	0.997759	CS pos: 30-31. Pr: 0.4105

TMHMM  Annotations     

There is no transmembrane helices in AFUB_030040-T-p1.