CAZyme Information: AFUB_017670-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_017670-T-p1
• CAZy Family: CE15
• CAZyme Description: Ortholog(s) have acetylxylan esterase activity and role in xylan catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	scf_000002_A_fumigatus_A1163|CGC31	46106.56	6.6334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000002_A_fumigatus_A1163:120699-122523(+)

Full Sequence      

MVLETGFSAVARLNPYPGQAEIITLDKKTWRNYKPSAKEISYKGRWDDKHISWWSAPGFK
LAFTGAKLALSFGQYTSQGVLVAYRLGGQDWQFSNVTANATYQFIGPTTTGLNLTNAGDA
KSFELRGRHLQTGPTDTCPRSVYRRNLLTMSTIQLAGVSVAADATISRIDEYPKMVEIIG
DSLSSGDFATYEGLSSWAYDFAAGLGNVEYSITAYPGICLHDQNCWGNPRGQAYQWYRTS
DTSWRAHEIYGDNPPKWNFAAQRPADLVVINIGTNDNNPANNVSSTDYYNDYITLVGNIH
KIWPKADIVLMSLWGGFGASGDTYVQGPLWVDEIKRVYQHYEKQGFIHYFDTAGILQHND
IAPQWHPTDVGHLKIAAHLMQWVKLKFGWEFGATGPEVYHGTLYWNDQANY

Enzyme Prediction     

No EC number prediction in AFUB_017670-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	177	382	7e-24	0.9808612440191388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	5.52e-57	175	384	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	6.93e-17	176	381	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	3.62e-15	178	372	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238865	sialate_O-acetylesterase_like1	6.79e-06	255	381	53	185	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238863	SGNH_hydrolase_peri1	6.86e-05	259	312	51	103	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17295.1|CE0	7.16e-206	2	411	18	400
QMW34907.1|CE0	3.73e-172	2	411	18	398
QMW46983.1|CE0	3.73e-172	2	411	18	398
QRD91240.1|CE0	3.73e-172	2	411	18	398
EAA62480.1|CE0	6.28e-151	2	411	19	307

PDB Hits     

AFUB_017670-T-p1 has no PDB hit.

Swiss-Prot Hits     

AFUB_017670-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999955	0.000083

TMHMM  Annotations     

There is no transmembrane helices in AFUB_017670-T-p1.