CAZyme Information: AFUB_016620-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_016620-T-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: Ortholog(s) have carbon-oxygen lyase activity, acting on polysaccharides activity and role in pectin catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		73531.67	5.7577

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000001_A_fumigatus_A1163:4720577-4722710(-)

Full Sequence      

MRFAIPLGAACAWAGVALAALQIAEDFSSITLNNDRFKAVWSKSKGSVVDMFLDGQDLLG
PQSGSTGIGPYLDCYCVPSGFYTAGATNPRMQYVEGTDSTGTKYAGVILNDTYTPTGQQF
QQYWFLRDGETGLHMFSRLAYYNETTPFLRNLQEFRTLFRPNTQLWTHLTSSELQTAPLP
SKNAVSKQVVVQDATWRFNNTPDDAYYTQFSEYFTKYTFSNQWRDNDVHGLYGDGTNSNG
STYGAWLVMNTKGPLHSDLTVDGIVYNYIVSNHHGEGTPNITNGFDRTFGPQFYLFNGGK
GSTSSLQDLRSEAAKLADPSWNAEFYDSIAKHVVGYVPSSKRGSVDGRIKLPKGASNPIA
ILTVDGQYFQDNSVVPSSYQYWTDIDTSGRFRIDRVVEGKYRLTVYADGIFGDFVRDGVT
VRAGKTTTVKEKWDAESAGKEIWRLGTPDKSSGEFRHGVARDPTHPLHPPEYLIYWGAYD
WQSDFPKGIDYTIGSSDPATDFNTVHWSVFGPTPDNPNVEYNTTHDWKINFSLTKKQLRN
SKKATLTIQLAGAKTASGNTDEYKASEPYINLIHESYINDQKEPLSFVIGFNQSSSCIVR
SAVSCYQVRSRMEFPADWLKVGENTLTLHLPYNATDTETAILPATVYVQYDALRLELD

Enzyme Prediction     

EC	4.2.2.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	19	643	0	0.9968354430379747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	4.25e-56	23	299	3	259	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	1.38e-34	341	430	1	90	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199905	RGL4_C	1.03e-32	443	656	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	3.67e-28	352	428	1	74	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.
405384	CBM-like	3.76e-20	442	655	2	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW42683.1|PL4_3	0.0	1	657	1	662
QMW30630.1|PL4_3	0.0	1	657	1	662
QRD89518.1|PL4_3	0.0	1	657	1	662
UDD59449.1|PL4_3	0.0	1	657	1	662
BCS26666.1|PL4_3	0.0	1	657	1	660

PDB Hits     

AFUB_016620-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XPA2|RGLB_ASPFC	0.0	1	658	1	658	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rglB PE=3 SV=1
sp|A1D144|RGLB_NEOFI	0.0	1	658	1	658	Probable rhamnogalacturonate lyase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rglB PE=3 SV=1
sp|A5ABH4|RGLB_ASPNC	0.0	1	646	1	651	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
sp|Q0C7K7|RGLB_ASPTN	0.0	1	657	1	659	Probable rhamnogalacturonate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rglB PE=3 SV=1
sp|B8N5T6|RGLB_ASPFN	0.0	1	657	1	662	Probable rhamnogalacturonate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.013825	0.986151	CS pos: 19-20. Pr: 0.9414

TMHMM  Annotations     

There is no transmembrane helices in AFUB_016620-T-p1.