CAZyme Information: AFUB_016500-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_016500-T-p1
• CAZy Family: CBM63
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, oxidoreductase activity, acting on CH-OH group of donors activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	scf_000001_A_fumigatus_A1163|CGC30	82435.45	7.4843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000001_A_fumigatus_A1163:4681082-4683451(+)

Full Sequence      

MAEQAVTAYVPLDVPLPPIPEGQVFSDLQWRTLLSLADTVIPSIRSTSLPKSVSTKVVPE
STFKDAVSTLASHIHDPDATQIAEQYLEENASANPQFVEGLRRLFAEYIHEEGKSGINLI
LNALNSKAGSLILTGSTTPIQDQPFEIREKIFSSWETSRIKPLRAIYRAFTAIFKKTWAT
VSPTIRSVVGCPRVPIHGKPADGFEYEFLQFPPGAEPETIDTDVVIVGSGCGGSVAAKNL
AEAGYRVLVVEKSYHYPSKYFPMDFNEGFVSMFENGGATTSDDGSIAVLAGSTWGGGGTV
NWSASLQTQGYVRREWASKGLPFFESHEYQQALDRVCDRMGVSNDHTEHNYSNRVLLDGA
RKLGYAAQPVPQNTGGSNHYCGYCTMGCHSCGKKGPRETFLADAAKAGTTFIEGFRADKI
RFKNTKGGRVACGVEGTWTSRDSYLGTAGPDRTTRKVIINASKVIVSCGTLHSPLLLLRS
GLKNPQIGRNLYLHPVVLSCAVFDEEIRPWEGSALTIVVNEFEDQDGQGHGVKIENVVML
PALYLPTFPWRDGLDYKLWAAKLPRMSGFIALTKERDAGRVYPDPADGRVRIDYTVSAYD
RKHIVEALIATAKIAYISGAREFHTSNREMPPFIRPTEASDPNAPEGVTNQALQAWIAVL
RRKNPVDPERTQYASAHQMGTCRMGSSPRTSVVDPECQVWGTQGLYVMDASVFPSASGVN
PMVTNMAIADWASRKVVRSLEKANHGKTVLARL

Enzyme Prediction     

No EC number prediction in AFUB_016500-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	218	744	3.8e-52	0.5161812297734628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	4.47e-61	272	496	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	3.24e-48	223	738	9	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.62e-33	576	729	2	140	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	1.29e-14	222	733	1	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	1.22e-10	677	752	473	539	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	5.87e-195	1	740	1	734
QRD90948.1|AA3_1|AA8	1.58e-15	223	737	305	855
EGX44283.1|AA3_1|AA8|CBM1	1.43e-14	223	746	252	793
BAE61169.1|AA3_1|AA8	1.77e-14	223	737	255	787
QMW43910.1|AA3_1|AA8	5.60e-14	223	737	309	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	1.63e-11	217	737	225	764	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	1.56e-07	217	737	3	543	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	1.82e-07	217	737	225	765	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	3.40e-07	223	737	4	535	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	3.42e-07	223	737	9	540	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.14e-87	220	744	237	750	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|O65709|FAO4A_ARATH	3.65e-85	220	742	222	724	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|B5WWZ8|FAO1_LOTJA	8.24e-84	220	742	235	746	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	4.19e-83	91	741	61	743	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9LW56|FAO3_ARATH	2.80e-78	220	740	231	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AFUB_016500-T-p1.